DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and Opbp

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster


Alignment Length:356 Identity:87/356 - (24%)
Similarity:149/356 - (41%) Gaps:74/356 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VGVFQLIEGCIVPGTFKPIKD------ILKYFEKIINQRLELLPNSAACRDCLEYLFNYDRLVRN 75
            |.:::|:|.  ||...|..||      ..:||                |.||       ..:..|
  Fly    89 VPLWELVEE--VPANVKAEKDQNEPSNSDRYF----------------CYDC-------HSIFEN 128

  Fly    76 LSQVQRQIADALLGCRQVEGKAETKQQAAKRARVQVPAFKIVQATALKEPERQPGEEDEC----- 135
            .::.:..|      |.:.|....::|....:|.|:   .|:...:|...| |.......|     
  Fly   129 RNKAEEHI------CPRAESGGSSQQDGDAKAPVR---RKLASVSARTGP-RDASSVISCGICNT 183

  Fly   136 ----EEFMKEEM-LDEEFQFSEPDDSMPSSEEEFFTETTEIPCHICGEMFSSQEVLERHIKADTC 195
                |:|:|..| :.|........|::|....:.::|..:..|.||.:.| .:.:|..| |....
  Fly   184 VFSSEKFLKFHMRIHENRAPKSIQDALPIGAHQQYSELDQFYCEICNKSF-DETLLTVH-KQMHQ 246

  Fly   196 QKSEQATCNVCGLKVKDDEVLDLHMNLHE------------GKTELE-------CRYCDKKFSHK 241
            |:|.:..|::|..|.:::....:|..:||            .:|.|:       |:||::.|:..
  Fly   247 QESSEIMCSICNRKFENEVTYQMHQKIHEKPRDSESSRKLAQRTSLDKEKPGFPCQYCERVFTRP 311

  Fly   242 RNVLRHMEVHWDKKKYQCDKCGERFSLSWLMYNHLMRHDAEENALICEVCHQQFKTKRTYKHHLR 306
            ...::|..||..:|.|.|:.||:.|.:|:.:..||..| ......:|.||:::||:.:.|.||||
  Fly   312 FEKVKHERVHTGEKPYACEVCGKTFRVSYSLTLHLRTH-TNIRPYVCTVCNKRFKSHQVYSHHLR 375

  Fly   307 THQTDRPRYPCPDCEKSFVDKYTLKVHKRVH 337
            .|.::| ::.|..|.|:|.....|..||..|
  Fly   376 IHSSER-QFSCDACPKTFRTSVQLYAHKNTH 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 4/19 (21%)
C2H2 Zn finger 231..251 CDD:275368 5/19 (26%)
C2H2 Zn finger 259..308 CDD:275368 18/48 (38%)
C2H2 Zn finger 288..303 CDD:275370 6/14 (43%)
zf-C2H2 315..337 CDD:278523 7/21 (33%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 4/19 (21%)
C2H2 Zn finger 301..321 CDD:275368 5/19 (26%)
zf-H2C2_2 316..336 CDD:290200 8/19 (42%)
C2H2 Zn finger 329..349 CDD:275368 7/19 (37%)
zf-H2C2_2 341..366 CDD:290200 7/25 (28%)
C2H2 Zn finger 357..377 CDD:275368 10/19 (53%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
C2H2 Zn finger 411..431 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.