DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and Zfp7

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001345745.1 Gene:Zfp7 / 223669 MGIID:99208 Length:685 Species:Mus musculus


Alignment Length:376 Identity:84/376 - (22%)
Similarity:136/376 - (36%) Gaps:88/376 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LLPNSAACRDCLEYLFNYDRLVRNLSQVQRQIADALLGCRQVEGKAETKQQAAKRA--------- 107
            :|.|.::......:|.....|:..|.|.|......|.|....|.....:..:|.|.         
Mouse    33 MLENHSSVAGLAGFLVFKPELISRLEQGQEPWVLDLQGAEGTEAPRICQTDSAIRTDRKQTCEYT 97

  Fly   108 ---RVQVPAF-----------------------KIVQATALKEPERQP--GEEDECEEFMKEEML 144
               :.|:|.|                       .:.|...|......|  ..:|..:|..:.:..
Mouse    98 SLLQRQIPGFGDNLDSKVWSENCPRSLGLSVSGSLFQKHRLNSEAVMPKNSTKDAVQERKELQAT 162

  Fly   145 DEEFQFSEPDD-------------SMPSSEEEFFTETTEIPCHICGEMFSSQEVLERHIKADTCQ 196
            |..::   |||             |:|:.|..:       ||..||:.|..:..|.:|..:.|.:
Mouse   163 DVGYR---PDDQRDHLSSKLIRRQSVPTGENRY-------PCEECGKAFRWRSRLNQHKLSHTGE 217

  Fly   197 KSEQAT--------------------------CNVCGLKVKDDEVLDLHMNLHEGKTELECRYCD 235
            ||.|..                          |:.||.:.....||..|..:|.|:...:|..|.
Mouse   218 KSYQCNKCTKVFASSSRLIRHQRAHTGEKPFKCDQCGKRFVLASVLTQHQRIHTGERPFKCAECG 282

  Fly   236 KKFSHKRNVLRHMEVHWDKKKYQCDKCGERFSLSWLMYNHLMRHDAEENALICEVCHQQFKTKRT 300
            |.|.....:::|..:|..:|.|:|::||:.|..|..:.:|...|.. |...||:.|.:.|..:..
Mouse   283 KGFHLSAKLVQHQRIHTGEKPYRCEECGKTFGQSSSLVHHQRIHTG-ERPFICQECGKAFCQRSQ 346

  Fly   301 YKHHLRTHQTDRPRYPCPDCEKSFVDKYTLKVHKRVHQPVEKPESAEAKEA 351
            ...|.|||..:|| |.|.:|.|:|..:.||..|:::....||.:...|.|:
Mouse   347 LSRHRRTHTGERP-YSCQECGKAFCQRATLAQHQKMMHTAEKSQMPRASES 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 6/19 (32%)
C2H2 Zn finger 231..251 CDD:275368 5/19 (26%)
C2H2 Zn finger 259..308 CDD:275368 14/48 (29%)
C2H2 Zn finger 288..303 CDD:275370 3/14 (21%)
zf-C2H2 315..337 CDD:278523 8/21 (38%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
Zfp7NP_001345745.1 KRAB 4..65 CDD:214630 7/31 (23%)
C2H2 Zn finger 194..214 CDD:275368 6/19 (32%)
C2H2 Zn finger 222..242 CDD:275368 0/19 (0%)
COG5048 246..668 CDD:227381 46/153 (30%)
C2H2 Zn finger 250..270 CDD:275368 6/19 (32%)
C2H2 Zn finger 278..298 CDD:275368 5/19 (26%)
C2H2 Zn finger 306..326 CDD:275368 6/19 (32%)
C2H2 Zn finger 334..354 CDD:275368 5/19 (26%)
C2H2 Zn finger 362..380 CDD:275368 7/17 (41%)
C2H2 Zn finger 414..434 CDD:275368
C2H2 Zn finger 442..462 CDD:275368
C2H2 Zn finger 470..490 CDD:275368
C2H2 Zn finger 498..518 CDD:275368
C2H2 Zn finger 526..546 CDD:275368
C2H2 Zn finger 554..574 CDD:275368
C2H2 Zn finger 582..602 CDD:275368
C2H2 Zn finger 635..655 CDD:275368
C2H2 Zn finger 663..683 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.