DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and sdz-12

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_494634.1 Gene:sdz-12 / 184388 WormBaseID:WBGene00017406 Length:330 Species:Caenorhabditis elegans


Alignment Length:172 Identity:45/172 - (26%)
Similarity:67/172 - (38%) Gaps:27/172 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 ETTEIP-CHICGEMFSSQEVLERHIKADTCQKSEQATCNVCGLKVKDDEVLDLHMNLHEGKTELE 230
            ::.::| |.:|...|::|:.|..|:|..||:.......|                  |    :..
 Worm    22 DSAKVPQCQVCKRKFANQKTLRTHMKHITCRPGRSNVVN------------------H----KFR 64

  Fly   231 CRYCDKKFSHKRNVLRHMEVHWDKKKYQCDKCGERFSLSWLMYNHLMRHDAEENALICEV--CHQ 293
            |..|:|:|::|.|:.||...|...|..:|..|...|.....:..||..|..|.:...|.|  |..
 Worm    65 CENCEKQFTNKPNLKRHQITHSGSKSKKCSTCQRTFFREDQLQRHLHNHLKERSHFDCPVLNCSM 129

  Fly   294 QFKTKRTYKHHLRTHQ--TDRPRYPCPDCEKSFVDKYTLKVH 333
            ||......::||..|.  :.....||..|.|.|.....|.||
 Worm   130 QFVFYEGVENHLVNHHHFSYSESAPCGKCHKLFGSPRHLLVH 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 1/19 (5%)
C2H2 Zn finger 231..251 CDD:275368 8/19 (42%)
C2H2 Zn finger 259..308 CDD:275368 14/50 (28%)
C2H2 Zn finger 288..303 CDD:275370 5/16 (31%)
zf-C2H2 315..337 CDD:278523 8/19 (42%)
C2H2 Zn finger 317..337 CDD:275368 7/17 (41%)
sdz-12NP_494634.1 SFP1 <25..86 CDD:227516 20/82 (24%)
C2H2 Zn finger 29..48 CDD:275368 6/18 (33%)
COG5236 <32..>197 CDD:227561 43/162 (27%)
C2H2 Zn finger 65..85 CDD:275368 8/19 (42%)
C2H2 Zn finger 93..113 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.