DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and unc-98

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_509284.2 Gene:unc-98 / 181020 WormBaseID:WBGene00006827 Length:310 Species:Caenorhabditis elegans


Alignment Length:279 Identity:54/279 - (19%)
Similarity:87/279 - (31%) Gaps:92/279 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 EEDECEEFM-----------KEEMLDEEFQFSEPDDSMPSSEEEFFTETTEIPCHICGEMFSSQE 184
            |.|:.||.|           ..||:.....|....:|..:..:|...|..::..          .
 Worm    12 ERDDFEELMNACDLAKMSVKNNEMVHGLETFGINGESSENGNKEKPKEIMKVVA----------P 66

  Fly   185 VLERHIKADTCQK-----------SEQATCNVCGLKVKDDEVLDLHMNLHEGKTELECRYCDKKF 238
            .:|.::.:.:.|.           |:|......|..|:.|:         .|....:||:|...|
 Worm    67 TVEAYVGSSSAQTPTKSSGGALDGSDQQEVRQDGTSVQKDD---------NGFVFYKCRFCGLTF 122

  Fly   239 SHKRNVLRHMEVHWDKKKYQCDKCGERFSLSWLMYNHLMRHDAEENALICEVCHQQF--KTKRTY 301
            :....:..|..:|...:.|.|.|||:.|..:..:..|..:| :|.:...|| |.:.|  .|:..|
 Worm   123 NFMNTLRAHERIHDVSQPYVCGKCGDSFEFACQLEYHAAQH-SEIDGYKCE-CGRTFFSYTEMLY 185

  Fly   302 ----------------------------------------------KHHLRTHQTDRPR-YPCPD 319
                                                          ||.||.:...|.: |.|..
 Worm   186 HKHTDDPLELIGAPETTTIKVSKKRVLPVSEQDLPQPAFVTEGYEPKHPLRVYNDVRSKPYICEY 250

  Fly   320 CEKSFVDKYTLKVHKRVHQ 338
            |.||:.|...|..|...|:
 Worm   251 CSKSYSDSRGLAYHMYSHR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 3/19 (16%)
C2H2 Zn finger 231..251 CDD:275368 5/19 (26%)
C2H2 Zn finger 259..308 CDD:275368 18/96 (19%)
C2H2 Zn finger 288..303 CDD:275370 6/62 (10%)
zf-C2H2 315..337 CDD:278523 8/21 (38%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
unc-98NP_509284.2 C2H2 Zn finger 115..135 CDD:275368 5/19 (26%)
C2H2 Zn finger 143..163 CDD:275368 6/19 (32%)
SFP1 <169..268 CDD:227516 19/99 (19%)
C2H2 Zn finger 171..189 CDD:275368 6/18 (33%)
C2H2 Zn finger 248..268 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.