DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and klu-1

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_493611.2 Gene:klu-1 / 173366 WormBaseID:WBGene00013970 Length:543 Species:Caenorhabditis elegans


Alignment Length:192 Identity:48/192 - (25%)
Similarity:74/192 - (38%) Gaps:58/192 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 EEFQFSEPDDSMPSSEEEFFTETTEIPCHICGEMFSSQEVLERHIKADTCQKSEQATCNVCGLKV 210
            ::..|:..|||..:.:.::       ||.:||:.|:..:.|.:||    ..:..|.:|.:     
 Worm   314 DDMTFAPRDDSSRAKQMQY-------PCTLCGQAFAVHDRLAKHI----ASRHRQRSCTL----- 362

  Fly   211 KDDEVLDLHMNLHEGKTELECRYCDKKFSHKRNVLRHMEVHWDKKKYQCDKCGERFSLSWLMYNH 275
              |:...:|          :|..|.|.||....:.|||.:|...|.|.|..|.:.||.|    :|
 Worm   363 --DDASKVH----------KCNMCSKSFSRSDMLTRHMRLHTGAKPYSCPTCNQVFSRS----DH 411

  Fly   276 LMRHDAEENALICEVCHQQFKTKRTYKHHLRTHQTDRPRYPCPDCEKSFVDKYTLKVHKRVH 337
            |                         ..|||||..::| |.||.|..|...:..:..|.|.|
 Worm   412 L-------------------------STHLRTHTGEKP-YACPMCNYSASRRDMISRHMRTH 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 3/19 (16%)
C2H2 Zn finger 231..251 CDD:275368 8/19 (42%)
C2H2 Zn finger 259..308 CDD:275368 10/48 (21%)
C2H2 Zn finger 288..303 CDD:275370 0/14 (0%)
zf-C2H2 315..337 CDD:278523 7/21 (33%)
C2H2 Zn finger 317..337 CDD:275368 6/19 (32%)
klu-1NP_493611.2 C2H2 Zn finger 334..354 CDD:275368 7/23 (30%)
zf-C2H2 369..391 CDD:278523 9/31 (29%)
C2H2 Zn finger 371..391 CDD:275368 8/19 (42%)
zf-H2C2_2 383..408 CDD:290200 9/24 (38%)
COG5048 395..>448 CDD:227381 23/83 (28%)
C2H2 Zn finger 399..419 CDD:275368 10/48 (21%)
zf-H2C2_2 411..436 CDD:290200 13/50 (26%)
C2H2 Zn finger 427..447 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.