DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and ZNF420

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001316444.1 Gene:ZNF420 / 147923 HGNCID:20649 Length:704 Species:Homo sapiens


Alignment Length:405 Identity:98/405 - (24%)
Similarity:157/405 - (38%) Gaps:83/405 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RPF-CFVCGKEKSVGVFQLIEGCIVPGTFKP--IKDILKYF----EKIINQRLELLPNSAACRDC 62
            :|: |..||| ..:...||.....|....||  .|:..|.|    :..::|||........|::|
Human   221 KPYKCEECGK-AFIRSSQLTRHQKVHTGEKPYECKECGKAFTQNSQLTLHQRLHTGEKLYECKEC 284

  Fly    63 LEYLFNYDRLVRNLSQVQRQI--ADALLGCRQVEGKA----ETKQQAAKRARVQVP--------A 113
            .:......:|:     :.::|  .:....|::. |||    ....|..|....:.|        |
Human   285 RKVFTQLSQLI-----LHKRIHTGEKPYECKEC-GKAFICGSQLSQHQKIHNGEKPYECKECGRA 343

  Fly   114 FKIVQATALKEPER-QPGEED-ECEE----FMKEEMLDEEFQFSEPDDSMPSSEEEFFTETTEIP 172
            |  ::.:.|.:.:| ..||:. :|||    |::...|              :..:...|......
Human   344 F--IRGSLLMQHQRIHTGEKPYKCEECGKAFIRGSQL--------------TQHQRIHTNEKPYE 392

  Fly   173 CHICGEMFSSQEVLERHIKADTCQKSEQATCNVCGLKVKDDEVLDLHMNLHEGKTELECRYCDKK 237
            |..||:|||....|.:|.:..|.:|..|  |..||.......:|..|..:|.|:...||:.|.|.
Human   393 CKECGKMFSHGSQLTQHQRIHTGEKPYQ--CKECGKAFNRGSLLTRHQRIHTGEKPYECKECGKT 455

  Fly   238 FSHKRNVLRHMEVHWDKKKYQCDKCGERF------------------------SLSWLMYNHLMR 278
            ||....:.:|..:|..:|.|:|.:||:.|                        .:::...:||.:
Human   456 FSRGSELTQHERIHTGEKPYECKECGKSFIRGSQLTQHQRIHTGEKPYECKECRMAFTQSSHLSQ 520

  Fly   279 HD---AEENALICEVCHQQFKTKRTYKHHLRTHQTDRPRYPCPDCEKSFVDKYTLKVHKRVHQPV 340
            |.   ..|...:|..|.:.|........|.|.|..::| |.|.:|.|:|:....|..|:|:|.. 
Human   521 HQRLHTGEKPYVCNECGKAFARGLLLIQHQRIHTGEKP-YQCKECGKAFIRGSQLTQHQRIHTG- 583

  Fly   341 EKPESAEAKEATVTF 355
            |||  .|.||....|
Human   584 EKP--YECKECGKAF 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 5/19 (26%)
C2H2 Zn finger 231..251 CDD:275368 6/19 (32%)
C2H2 Zn finger 259..308 CDD:275368 13/75 (17%)
C2H2 Zn finger 288..303 CDD:275370 3/14 (21%)
zf-C2H2 315..337 CDD:278523 8/21 (38%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
ZNF420NP_001316444.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.