DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sry-beta and LOC100538196

DIOPT Version :9

Sequence 1:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_017210984.1 Gene:LOC100538196 / 100538196 -ID:- Length:420 Species:Danio rerio


Alignment Length:276 Identity:77/276 - (27%)
Similarity:118/276 - (42%) Gaps:49/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 KIVQATALKEPERQPGEEDEC----EEFMKEEMLDEEFQFSEPDDSMPSSEEEFFTETTEI---- 171
            ||.:...:|:.:.|  |:.:.    |:..::..:||:.||.:|.: :.:.|:...|:.|.:    
Zfish    12 KIEETFTVKQEDLQ--EQTDLMVRKEQTNQQNEIDEKQQFEKPQE-ITTDEKPILTKKTSLNGRP 73

  Fly   172 ---------PCHICGEMFSSQEVLERHIKADT---------CQKS-----------------EQA 201
                     .|..|.:.||.:..|:.|::..|         |.||                 ...
Zfish    74 RKSESGCNFSCKQCRKSFSQKSKLDVHMRVHTREQPYTCEQCGKSFGQIQGFKAHMRIHTRERSY 138

  Fly   202 TCNVCGLKVKDDEVLDLHMNLHEGKTELECRYCDKKFSHKRNVLRHMEVHWDKKKYQCDKCGERF 266
            ||..||...........||.:|.|:....|:.|.|.||.|.|:..||.||..:|.|.|::||:.|
Zfish   139 TCQQCGKSFYHAGHFAAHMRIHTGEKPFSCKQCGKSFSQKSNLDVHMRVHTGEKPYTCEQCGKSF 203

  Fly   267 SLSWLMYNHLMRHDAEENALICEVCHQQFKTKRTYKHHLRTHQTDRPRYPCPDCEKSFVDKYTLK 331
            |.......|:..|..|.:. .|:.|.:.|:..|....|:|||..::| :.|..|.|||..|..|.
Zfish   204 SQKQNFKTHMRIHTGERSC-TCQQCGKSFRHARNLAVHMRTHTGEKP-FSCKQCRKSFSKKLNLI 266

  Fly   332 VHKRVHQPVEKPESAE 347
            .|.|||.. |||.:.|
Zfish   267 AHMRVHTR-EKPYTCE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 5/19 (26%)
C2H2 Zn finger 231..251 CDD:275368 9/19 (47%)
C2H2 Zn finger 259..308 CDD:275368 14/48 (29%)
C2H2 Zn finger 288..303 CDD:275370 4/14 (29%)
zf-C2H2 315..337 CDD:278523 9/21 (43%)
C2H2 Zn finger 317..337 CDD:275368 9/19 (47%)
LOC100538196XP_017210984.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.