DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment janA and Phpt1

DIOPT Version :9

Sequence 1:NP_788762.1 Gene:janA / 43569 FlyBaseID:FBgn0001280 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_083569.1 Gene:Phpt1 / 75454 MGIID:1922704 Length:124 Species:Mus musculus


Alignment Length:120 Identity:46/120 - (38%)
Similarity:71/120 - (59%) Gaps:6/120 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LAGVPLVHISPEGIFKYVMINVF---DGGDAS---KAVIRGFADCTWHADIFEREEEVFKKLGLR 80
            |..:|.|.|..:|:||||:|.|.   ..||.:   |.::||:....:||||:::.....::.|..
Mouse     5 LGQIPDVDIDSDGVFKYVLIRVHLAEPSGDPAKECKEIVRGYKWAEYHADIYDKVSGELQRNGYD 69

  Fly    81 AECPGGGRIEHNPEKKYLKVYGYSQGFGKADHAQTKRILATKYPDYTIEISDEGY 135
            .||.|||||.|..:.:.:.|||||.|:|:|.|:.:...:..|||||.:..:|:||
Mouse    70 CECLGGGRISHQSQDRKIHVYGYSMGYGRAQHSVSTEKIKAKYPDYEVTWADDGY 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
janANP_788762.1 Ocnus 25..124 CDD:368235 38/104 (37%)
Phpt1NP_083569.1 Ocnus 8..113 CDD:398603 38/104 (37%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q9NRX4 93..95 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842377
Domainoid 1 1.000 88 1.000 Domainoid score I7936
eggNOG 1 0.900 - - E1_2CUCZ
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8573
Inparanoid 1 1.050 97 1.000 Inparanoid score I5019
Isobase 1 0.950 - 0 Normalized mean entropy S3696
OMA 1 1.010 - - QHG58752
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004659
OrthoInspector 1 1.000 - - oto92599
orthoMCL 1 0.900 - - OOG6_105614
Panther 1 1.100 - - LDO PTHR12258
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3609
SonicParanoid 1 1.000 - - X3271
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.