DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment janA and si:dkey-51e6.1

DIOPT Version :9

Sequence 1:NP_788762.1 Gene:janA / 43569 FlyBaseID:FBgn0001280 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_001025290.2 Gene:si:dkey-51e6.1 / 558617 ZFINID:ZDB-GENE-041014-198 Length:115 Species:Danio rerio


Alignment Length:110 Identity:46/110 - (41%)
Similarity:66/110 - (60%) Gaps:1/110 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EALAGVPLVHISPEGIFKYVMINV-FDGGDASKAVIRGFADCTWHADIFEREEEVFKKLGLRAEC 83
            :||:.||.|.|.|||:.||:.:|: ..||:..|.::||.....:|..||::.....:.|||...|
Zfish     3 DALSKVPDVDIDPEGVSKYIQVNLKVKGGNDHKVIVRGTKTAEYHNHIFQKVNPAMEALGLECNC 67

  Fly    84 PGGGRIEHNPEKKYLKVYGYSQGFGKADHAQTKRILATKYPDYTI 128
            .|||:|:||..:|.|:|:|.|..:||||||.|...|...:.||.|
Zfish    68 LGGGKIDHNNTEKKLRVFGESTAYGKADHAVTVEKLKCVFKDYEI 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
janANP_788762.1 Ocnus 25..124 CDD:368235 41/99 (41%)
si:dkey-51e6.1NP_001025290.2 Ocnus 8..108 CDD:282814 41/99 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586807
Domainoid 1 1.000 97 1.000 Domainoid score I7191
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58752
OrthoDB 1 1.010 - - D1529401at2759
OrthoFinder 1 1.000 - - FOG0004659
OrthoInspector 1 1.000 - - otm26357
orthoMCL 1 0.900 - - OOG6_105614
Panther 1 1.100 - - O PTHR12258
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3609
SonicParanoid 1 1.000 - - X3271
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.890

Return to query results.
Submit another query.