DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment janA and CG18662

DIOPT Version :9

Sequence 1:NP_788762.1 Gene:janA / 43569 FlyBaseID:FBgn0001280 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_652561.1 Gene:CG18662 / 50437 FlyBaseID:FBgn0040963 Length:146 Species:Drosophila melanogaster


Alignment Length:130 Identity:42/130 - (32%)
Similarity:71/130 - (54%) Gaps:3/130 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSKGLRLIHKMSEEALAGVPLVHISPEGIFKYVMINVFDGGD--ASKAVIRGFADCTWHADIFER 69
            :.:..||..:....:|...|:..:. .|..||:|.:|:..|:  ::|.|||..:...:|.|:::.
  Fly    15 MMQAARLYCEKPMRSLVAFPVAKVE-SGKSKYMMAHVYIHGEMGSAKQVIRSLSKAKYHLDVYDE 78

  Fly    70 EEEVFKKLGLRAECPGGGRIEHNPEKKYLKVYGYSQGFGKADHAQTKRILATKYPDYTIEISDEG 134
            .::..:.:||..:..|||.:.|:.||||:|:||.||..|||||...:.||...|.|:.|:....|
  Fly    79 LKKEAESMGLCTQGLGGGYLVHDKEKKYIKLYGRSQALGKADHEAAREILQPIYTDHKIDAESGG 143

  Fly   135  134
              Fly   144  143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
janANP_788762.1 Ocnus 25..124 CDD:368235 35/100 (35%)
CG18662NP_652561.1 Ocnus 33..133 CDD:282814 35/100 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456946
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58752
OrthoDB 1 1.010 - - D1529401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.