DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment janA and ocn

DIOPT Version :9

Sequence 1:NP_788762.1 Gene:janA / 43569 FlyBaseID:FBgn0001280 Length:135 Species:Drosophila melanogaster
Sequence 2:NP_524578.1 Gene:ocn / 43567 FlyBaseID:FBgn0041102 Length:148 Species:Drosophila melanogaster


Alignment Length:139 Identity:46/139 - (33%)
Similarity:75/139 - (53%) Gaps:13/139 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRLQLLSKGLRLIHKMSEEA-------LAGVPLVHISPEGIFKYVMINVFDGG--DASKAVIRG 56
            |..|.||:...:|:..:..::       |..||.|.:| :|..||:::.:...|  ...:.::||
  Fly     1 MKTLNLLAPVSQLLKPLRRQSSSRVNALLINVPRVQLS-KGKNKYLLMMIHMHGLTRFGRTIVRG 64

  Fly    57 FADCTWHADIFEREEEVFKKLGLRAECPGGGRIEHNPEKKYLKVYGYSQGFGKADHAQTKRILA- 120
            .|... |.:|||..::...|:|:.|:|.|||.|.:..:||.:|:||..:.||:|.|.:||.||. 
  Fly    65 SASKD-HEEIFEEIQKEMDKIGICAKCLGGGFISNKEDKKVMKIYGCCKTFGEAPHGRTKDILLS 128

  Fly   121 -TKYPDYTI 128
             ||:..|.|
  Fly   129 WTKFQHYNI 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
janANP_788762.1 Ocnus 25..124 CDD:368235 38/102 (37%)
ocnNP_524578.1 Ocnus 32..129 CDD:282814 36/98 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456947
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3696
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1529401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.