DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment janA and phpt1

DIOPT Version :9

Sequence 1:NP_788762.1 Gene:janA / 43569 FlyBaseID:FBgn0001280 Length:135 Species:Drosophila melanogaster
Sequence 2:XP_002940786.1 Gene:phpt1 / 100497662 XenbaseID:XB-GENE-979475 Length:121 Species:Xenopus tropicalis


Alignment Length:121 Identity:52/121 - (42%)
Similarity:73/121 - (60%) Gaps:2/121 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MSEEALAGVPLVHISPEGIFKYVMINVF--DGGDASKAVIRGFADCTWHADIFEREEEVFKKLGL 79
            |:.|.|..:|.|.|.|:|.||||:|.|.  :|.:..|.::||:....:||||:::.....:|...
 Frog     1 MAAEGLVRIPEVDIDPDGTFKYVLIRVHIKEGSEEYKDIVRGYGWAEYHADIYDKVSADVEKGVY 65

  Fly    80 RAECPGGGRIEHNPEKKYLKVYGYSQGFGKADHAQTKRILATKYPDYTIEISDEGY 135
            ..||.|||||.|..:.|.:.:||||.|||:|.||.|...:..|||||.:..:||||
 Frog    66 DCECLGGGRIRHASQAKKIHIYGYSLGFGRARHAVTMEKVKAKYPDYEVTWADEGY 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
janANP_788762.1 Ocnus 25..124 CDD:368235 41/100 (41%)
phpt1XP_002940786.1 Ocnus 9..110 CDD:368235 41/100 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I7731
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8573
Inparanoid 1 1.050 101 1.000 Inparanoid score I4855
OMA 1 1.010 - - QHG58752
OrthoDB 1 1.010 - - D1529401at2759
OrthoFinder 1 1.000 - - FOG0004659
OrthoInspector 1 1.000 - - otm47906
Panther 1 1.100 - - LDO PTHR12258
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3609
SonicParanoid 1 1.000 - - X3271
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.