DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment janA and LOC100494164

DIOPT Version :9

Sequence 1:NP_788762.1 Gene:janA / 43569 FlyBaseID:FBgn0001280 Length:135 Species:Drosophila melanogaster
Sequence 2:XP_002933800.1 Gene:LOC100494164 / 100494164 -ID:- Length:120 Species:Xenopus tropicalis


Alignment Length:116 Identity:45/116 - (38%)
Similarity:68/116 - (58%) Gaps:3/116 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ALAGVPLVHISPEGIFKYVMINVFDGG---DASKAVIRGFADCTWHADIFEREEEVFKKLGLRAE 82
            ||..|..|.|.|||:|||:::.|..|.   :..:.::||.....:|..||::.....:.|||..:
 Frog     3 ALESVAEVQIDPEGVFKYILLRVSSGNSDPEQHRDIVRGTKSAEFHNHIFDKVNPEIQALGLECK 67

  Fly    83 CPGGGRIEHNPEKKYLKVYGYSQGFGKADHAQTKRILATKYPDYTIEISDE 133
            |.|||:||||.:.|.::::|.|.|:|||||:.|...|...|.||.:..||:
 Frog    68 CLGGGKIEHNNKDKKIRIFGESTGYGKADHSVTAEKLKKAYSDYEVTWSDD 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
janANP_788762.1 Ocnus 25..124 CDD:368235 38/101 (38%)
LOC100494164XP_002933800.1 Ocnus 7..108 CDD:368235 38/100 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I7731
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 101 1.000 Inparanoid score I4855
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1529401at2759
OrthoFinder 1 1.000 - - FOG0004659
OrthoInspector 1 1.000 - - otm47906
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3271
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.