DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment janB and si:dkey-51e6.1

DIOPT Version :9

Sequence 1:NP_476584.2 Gene:janB / 43568 FlyBaseID:FBgn0001281 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001025290.2 Gene:si:dkey-51e6.1 / 558617 ZFINID:ZDB-GENE-041014-198 Length:115 Species:Danio rerio


Alignment Length:117 Identity:40/117 - (34%)
Similarity:66/117 - (56%) Gaps:9/117 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SLVGVPRVKI-TKGQNRYLLVNIHTHGFTKYGRVIVRG---ADVDNHLAVFDSILEELEPEGICA 87
            :|..||.|.| .:|.::|:.||:...|...: :|||||   |:..||  :|..:...:|..|:..
Zfish     4 ALSKVPDVDIDPEGVSKYIQVNLKVKGGNDH-KVIVRGTKTAEYHNH--IFQKVNPAMEALGLEC 65

  Fly    88 KILGGGRILNEAENKKIKIYGTSRTFGGADHTRTRNILQAWTTYKDFKITVK 139
            ..||||:|.:....||::::|.|..:|.|||..|...|:.  .:||::||::
Zfish    66 NCLGGGKIDHNNTEKKLRVFGESTAYGKADHAVTVEKLKC--VFKDYEITME 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
janBNP_476584.2 Ocnus 31..128 CDD:282814 35/100 (35%)
si:dkey-51e6.1NP_001025290.2 Ocnus 8..108 CDD:282814 35/104 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586805
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58752
OrthoDB 1 1.010 - - D1529401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.