DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment janB and janA

DIOPT Version :9

Sequence 1:NP_476584.2 Gene:janB / 43568 FlyBaseID:FBgn0001281 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_788762.1 Gene:janA / 43569 FlyBaseID:FBgn0001280 Length:135 Species:Drosophila melanogaster


Alignment Length:136 Identity:48/136 - (35%)
Similarity:74/136 - (54%) Gaps:16/136 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KSLRLLPHIVSPFQKCYSTDLISLVGVPRVKIT-KGQNRYLLVNIHTHGFTKYGRVIVRG-ADVD 67
            |.|||: |.:|.         .:|.|||.|.|: :|..:|:::|:...|  ...:.::|| ||..
  Fly     9 KGLRLI-HKMSE---------EALAGVPLVHISPEGIFKYVMINVFDGG--DASKAVIRGFADCT 61

  Fly    68 NHLAVFDSILEELEPEGICAKILGGGRILNEAENKKIKIYGTSRTFGGADHTRTRNILQAWTTYK 132
            .|..:|:...|..:..|:.|:..|||||.:..|.|.:|:||.|:.||.|||.:|:.||.  |.|.
  Fly    62 WHADIFEREEEVFKKLGLRAECPGGGRIEHNPEKKYLKVYGYSQGFGKADHAQTKRILA--TKYP 124

  Fly   133 DFKITV 138
            |:.|.:
  Fly   125 DYTIEI 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
janBNP_476584.2 Ocnus 31..128 CDD:282814 36/98 (37%)
janANP_788762.1 Ocnus 25..124 CDD:368235 37/102 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456948
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3696
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1529401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.