DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment janB and Phpt1

DIOPT Version :9

Sequence 1:NP_476584.2 Gene:janB / 43568 FlyBaseID:FBgn0001281 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001100028.2 Gene:Phpt1 / 296571 RGDID:1311355 Length:124 Species:Rattus norvegicus


Alignment Length:113 Identity:34/113 - (30%)
Similarity:64/113 - (56%) Gaps:8/113 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VPRVKI-TKGQNRYLLVNIH----THGFTKYGRVIVRGAD-VDNHLAVFDSILEELEPEGICAKI 89
            :|.|.| :.|..:|:|:.:|    :....:..:.||||.. .:.|..::|.:..||:..|...:.
  Rat     8 IPDVDIDSDGIFKYVLIRVHLAEPSGDPARECKEIVRGYKWAEYHADIYDKVSGELQKNGYDCEC 72

  Fly    90 LGGGRILNEAENKKIKIYGTSRTFGGADHTRTRNILQAWTTYKDFKIT 137
            ||||||.::::::||.:||.|..:|.|.|:.:...::|  .|.|:::|
  Rat    73 LGGGRISHQSQDRKIHVYGYSMGYGRAQHSVSTEKIKA--KYPDYEVT 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
janBNP_476584.2 Ocnus 31..128 CDD:282814 30/102 (29%)
Phpt1NP_001100028.2 Ocnus 8..113 CDD:398603 31/106 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345807
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58752
OrthoDB 1 1.010 - - D1529401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12258
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.920

Return to query results.
Submit another query.