DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment janB and PHPT1

DIOPT Version :9

Sequence 1:NP_476584.2 Gene:janB / 43568 FlyBaseID:FBgn0001281 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_001274271.1 Gene:PHPT1 / 29085 HGNCID:30033 Length:127 Species:Homo sapiens


Alignment Length:117 Identity:34/117 - (29%)
Similarity:65/117 - (55%) Gaps:14/117 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VPRVKI-TKGQNRYLLVNIHTHGFTKYG------RVIVRG---ADVDNHLAVFDSILEELEPEGI 85
            :|.|.| :.|..:|:|:.:|:  ..:.|      :.||||   |:......::|.:..:::.:|.
Human     9 IPDVDIDSDGVFKYVLIRVHS--APRSGAPAAESKEIVRGYKWAEYHGEADIYDKVSGDMQKQGC 71

  Fly    86 CAKILGGGRILNEAENKKIKIYGTSRTFGGADHTRTRNILQAWTTYKDFKIT 137
            ..:.||||||.:::::|||.:||.|..:|.|.|..:...::|  .|.|:::|
Human    72 DCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKA--KYPDYEVT 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
janBNP_476584.2 Ocnus 31..128 CDD:282814 30/106 (28%)
PHPT1NP_001274271.1 Ocnus 9..116 CDD:282814 31/110 (28%)
Substrate binding. /evidence=ECO:0000305|PubMed:18991813 96..98 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152309
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3696
OMA 1 1.010 - - QHG58752
OrthoDB 1 1.010 - - D1529401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12258
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.