DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment janB and LOC100494164

DIOPT Version :9

Sequence 1:NP_476584.2 Gene:janB / 43568 FlyBaseID:FBgn0001281 Length:140 Species:Drosophila melanogaster
Sequence 2:XP_002933800.1 Gene:LOC100494164 / 100494164 -ID:- Length:120 Species:Xenopus tropicalis


Alignment Length:118 Identity:40/118 - (33%)
Similarity:69/118 - (58%) Gaps:9/118 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LISLVGVPRVKI-TKGQNRYLLVNIHT-HGFTKYGRVIVRG---ADVDNHLAVFDSILEELEPEG 84
            :.:|..|..|:| .:|..:|:|:.:.: :...:..|.||||   |:..||  :||.:..|::..|
 Frog     1 MAALESVAEVQIDPEGVFKYILLRVSSGNSDPEQHRDIVRGTKSAEFHNH--IFDKVNPEIQALG 63

  Fly    85 ICAKILGGGRILNEAENKKIKIYGTSRTFGGADHTRTRNILQAWTTYKDFKIT 137
            :..|.||||:|.:..::|||:|:|.|..:|.|||:.|...|:  ..|.|:::|
 Frog    64 LECKCLGGGKIEHNNKDKKIRIFGESTGYGKADHSVTAEKLK--KAYSDYEVT 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
janBNP_476584.2 Ocnus 31..128 CDD:282814 36/101 (36%)
LOC100494164XP_002933800.1 Ocnus 7..108 CDD:368235 36/104 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1529401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.