DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZIPIC and AT3G60580

DIOPT Version :9

Sequence 1:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_191617.1 Gene:AT3G60580 / 825229 AraportID:AT3G60580 Length:288 Species:Arabidopsis thaliana


Alignment Length:416 Identity:70/416 - (16%)
Similarity:128/416 - (30%) Gaps:144/416 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CKKCCEKLARYHKSIQIARKLRGEILELIHSPYMSKDHK------QTSYKEDDLDRETTISKFDG 109
            |:.|       .||....:.|.|.:     ..:||..|:      |.|| |.:.|..::..||  
plant     6 CRVC-------FKSFVNGKALGGHM-----RSHMSNSHEEEQRPSQLSY-ETESDVSSSDPKF-- 55

  Fly   110 NIEEAQQQDEEEQELESVGTTVTLVGPAGIVEEVAEEEHTFIIKQSEEEDEFHSVDLELDIDNEI 174
            ....:...::.|.|.||....:.|.....              |::.:.|.|        :..::
plant    56 AFTSSVLLEDGESESESSRNVINLTRKRS--------------KRTRKLDSF--------VTKKV 98

  Fly   175 IINEEEAHEVEEVAHEIEEVAHEIEEEDLLPHDKQEAQEEDFFKEDTMSDFDEHLDGAIEY-IIS 238
                           :..::.::.|.:...||..         ..||.::.|      :.: ::.
plant    99 ---------------KTSQLGYKPESDQEPPHSS---------ASDTTTEED------LAFCLMM 133

  Fly   239 DGEDQEQDNESSGEYTVNIQCPSCPEKFSSRRAYNVHTKREHFPGYVCDQCGKTLQSYSGFIGHL 303
            ...|:.:.|:|:.|....|      |.......||...:......|.|:.|||..:||....||.
plant   134 LSRDKWKKNKSNKEVVEEI------ETEEESEGYNKINRATTKGRYKCETCGKVFKSYQALGGHR 192

  Fly   304 QNHEPVKQFACPVCPERFSRKFRLKHHMAWHSGETPYQCDVCSKRFVHKVALYKHKMIHDSETKR 368
            .:|                :|.|:.::......||.|...|...:.:|:                
plant   193 ASH----------------KKNRVSNNKTEQRSETEYDNVVVVAKRIHE---------------- 225

  Fly   369 LECQVCGFKTRTKAHLERHMRSHTGDKPFACPVCNKRFSQMYNMKAHLREH--ESPGTNRHRRFH 431
                                          ||:|.:.|:....:..|.|.|  .:...|:.||.|
plant   226 ------------------------------CPICLRVFASGQALGGHKRSHGVGNLSVNQQRRVH 260

  Fly   432 CSKCTHTFINEQNYDAHVQRDDCTPV 457
            .::.....:.:.|..|..:.|:.:.|
plant   261 RNESVKQRMIDLNLPAPTEEDEVSVV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 8/19 (42%)
C2H2 Zn finger 314..334 CDD:275368 2/19 (11%)
zf-H2C2_2 327..351 CDD:290200 4/23 (17%)
C2H2 Zn finger 342..391 CDD:275368 2/48 (4%)
zf-H2C2_2 383..408 CDD:290200 4/24 (17%)
C2H2 Zn finger 399..419 CDD:275368 6/19 (32%)
C2H2 Zn finger 432..449 CDD:275368 2/16 (13%)
AT3G60580NP_191617.1 zf-C2H2_6 4..28 CDD:290623 6/33 (18%)
zf-C2H2_6 172..197 CDD:290623 10/40 (25%)
zf-C2H2_6 223..246 CDD:290623 7/68 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2552
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.