DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZIPIC and DAZ1

DIOPT Version :9

Sequence 1:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_179309.1 Gene:DAZ1 / 816223 AraportID:AT2G17180 Length:270 Species:Arabidopsis thaliana


Alignment Length:187 Identity:37/187 - (19%)
Similarity:58/187 - (31%) Gaps:73/187 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 CDQCGKTLQSYSGFIGHLQNHEPVKQFACPVCPERFSRKFRL--------------KHHMA---- 332
            |.:|||...|.....||::.| |.:|:.....|..|.|:...              :|::|    
plant    67 CTECGKQFGSLKALFGHMRCH-PERQWRGINPPSNFKRRINSNAASSSSSWDPSEEEHNIASCLL 130

  Fly   333 -WHSGETP---------YQCDVCSKRFVHKVALYKHKMIH------------------------- 362
             ..:|:.|         ::||.|.|.|....||..|:..|                         
plant   131 MMANGDVPTRSSEVEERFECDGCKKVFGSHQALGGHRATHKDVKGCFANKNITEDPPPPPPQEIV 195

  Fly   363 DSETKRLECQVCGFKTRTKAHLERHMRSHTGDKPFACPVCNKRFSQMYNMKAHLREH 419
            |.:..:....|.|...|                   |.:|::.||....:..|:|.|
plant   196 DQDKGKSVKLVSGMNHR-------------------CNICSRVFSSGQALGGHMRCH 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 7/19 (37%)
C2H2 Zn finger 314..334 CDD:275368 5/38 (13%)
zf-H2C2_2 327..351 CDD:290200 9/51 (18%)
C2H2 Zn finger 342..391 CDD:275368 13/73 (18%)
zf-H2C2_2 383..408 CDD:290200 3/24 (13%)
C2H2 Zn finger 399..419 CDD:275368 6/19 (32%)
C2H2 Zn finger 432..449 CDD:275368
DAZ1NP_179309.1 zf-C2H2_6 64..89 CDD:290623 8/22 (36%)
zf-C2H2_6 147..173 CDD:290623 9/25 (36%)
zf-C2H2_6 211..236 CDD:290623 8/42 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I2552
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.