DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZIPIC and Ctcfl

DIOPT Version :9

Sequence 1:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001342114.1 Gene:Ctcfl / 664799 MGIID:3652571 Length:646 Species:Mus musculus


Alignment Length:575 Identity:116/575 - (20%)
Similarity:184/575 - (32%) Gaps:228/575 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 KQTSYKEDDLDRETTISKFDGNIEEAQQQDEEEQELESVGTTVTLVGPAGIVEEVAEEEHTFIIK 153
            |:...|..||:.|    |.:..::..:.|:...:|:|:..:.:.|...|.:     |.:...:..
Mouse    17 KEQKLKPGDLEEE----KEEDGVQRVEAQEGVVKEVEAENSCLLLEARAPV-----ESDRRILTL 72

  Fly   154 QS---EEEDEF----------HSVDLE-----------------LDIDNEIIINE-------EEA 181
            |:   |.:|..          ||.:|.                 ||.:.::.:..       ||.
Mouse    73 QTVHLESQDVHLQGLGWLSVPHSEELSGTVPEAEGILQLPSVLWLDPEPQLSLQHCVTVSIPEEL 137

  Fly   182 HEVEE--------------VAHEIEEVAHEIEEEDLLPHDKQEAQEEDFFKEDTMSDFDEHLDGA 232
            :..||              :|.|..|:..:::|...|  .|.|..|:|.......:|..|.....
Mouse   138 YPPEELQRIHFHLLRENVLMAEENPELTPDLDESTAL--KKPEEDEKDQLPPQGETDKREERLLL 200

  Fly   233 IEYIISDGEDQE-------------QDNESSGEYTV-------------------NIQCPSCPEK 265
            :|....:|:|.|             ||..::.:.:|                   :.||.:||..
Mouse   201 LEMKPKEGKDDEIVLTISHLSLEEQQDPPAANQTSVPGAKAAKPKRRRQTKGKPQSFQCDTCPFT 265

  Fly   266 FSSRRAYNVHTK-----REHFPGYVCDQCGKTLQSYS----------------------GFI--- 300
            .|....:|.|.|     |.|    :|..|.|..::.:                      .|:   
Mouse   266 SSKLSTFNRHIKIHSNERPH----LCHLCLKAFRTVTLLRNHVNTHTGTRPHKCRDCDMAFVTSG 326

  Fly   301 --------------------------------GHLQNHEPVKQFACPVCPERFSRKFRLKHHMAW 333
                                            .|:::|...:.|.|..|.......::||.||..
Mouse   327 ELVRHRRYKHTYEKPFKCSLCKYASVEASKMKRHIRSHTGERPFQCCQCAYASRDSYKLKRHMRT 391

  Fly   334 HSGETPYQCDVCSKRF-------------------------------------VH---------- 351
            ||||.||:|..|..||                                     ||          
Mouse   392 HSGEKPYECPTCHVRFTQSGTMKIHIAQKHGENVPKYECPHCATIIARKSDLRVHLRNLHSQSPE 456

  Fly   352 -------------KVALYKHKMIHDSETKRLECQVCGFKTRTKAHLERHMRSHTGDKPFACPVCN 403
                         :.||.:|:..|.:| |:.:|:.|.:..:.:..|:.|||.|||:|||:|..||
Mouse   457 EMKCRYCPAGFHERYALIQHQRTHKNE-KKFKCKQCDYACKQERCLKAHMRMHTGEKPFSCLACN 520

  Fly   404 KRFSQMYNMKAHLREHESPG--TNRHRRFHCSKCTHTFINEQNYDAHVQRDDCTP 456
            |.|.|...:..|||::..|.  .|.|.   |.||...|....|...|  |..|.|
Mouse   521 KHFRQKQLLTVHLRKYHDPNFVPNLHL---CLKCDKRFSRWSNLQRH--RKKCDP 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 5/76 (7%)
C2H2 Zn finger 314..334 CDD:275368 6/19 (32%)
zf-H2C2_2 327..351 CDD:290200 14/60 (23%)
C2H2 Zn finger 342..391 CDD:275368 18/108 (17%)
zf-H2C2_2 383..408 CDD:290200 15/24 (63%)
C2H2 Zn finger 399..419 CDD:275368 9/19 (47%)
C2H2 Zn finger 432..449 CDD:275368 5/16 (31%)
CtcflNP_001342114.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..38 6/24 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..195 9/36 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..257 3/34 (9%)
COG5048 <256..491 CDD:227381 42/239 (18%)
C2H2 Zn finger 259..279 CDD:275368 7/19 (37%)
C2H2 Zn finger 287..307 CDD:275368 3/19 (16%)
C2H2 Zn finger 315..333 CDD:275368 1/17 (6%)
C2H2 Zn finger 344..364 CDD:275368 1/19 (5%)
C2H2 Zn finger 372..392 CDD:275368 6/19 (32%)
C2H2 Zn finger 400..417 CDD:275368 4/16 (25%)
C2H2 Zn finger 460..480 CDD:275368 3/19 (16%)
C2H2 Zn finger 488..508 CDD:275368 6/19 (32%)
C2H2 Zn finger 516..534 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.