DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZIPIC and CG1647

DIOPT Version :9

Sequence 1:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_651636.1 Gene:CG1647 / 43401 FlyBaseID:FBgn0039602 Length:1222 Species:Drosophila melanogaster


Alignment Length:454 Identity:85/454 - (18%)
Similarity:147/454 - (32%) Gaps:157/454 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CCICQF---------SVRVPKDIHTDTVGHPPVLISELVLQCTRGTNYVLTEESSTICKKCCEKL 58
            |.||:.         .:.:|.:  .||:......:|:.:.:....|..|..:...|||.:|.:|:
  Fly    17 CTICRLCGIDNPGKVPILLPNE--EDTIDLDEPRMSQKIYELVGFTVSVDDKMPQTICSQCVDKI 79

  Fly    59 ARYHKSIQIARKLRGEILELIHSPYMSKDHKQTSYKEDDLDRETTISKFDGNIEEAQQQDEEEQE 123
            ..::           |..|:.::     .:|||.                 |:...:|       
  Fly    80 NDFY-----------EFREMCYA-----TNKQTR-----------------NLLGLKQ------- 104

  Fly   124 LESVGTTVTLVGPAGIVE--EVAEEEHTFIIKQSEEEDEFHSVDLELDIDNEIIINEEEAHEVEE 186
                      :.||.:::  .:.:||...                     :..:.......:.||
  Fly   105 ----------IEPARLIDLKRIVKEERPI---------------------SGAVGKRGRKRKGEE 138

  Fly   187 VAHEIEEVAHEIEEEDLLPHDKQEAQEEDFF-----KEDTMSDFDEHLDGAIEYIISDGEDQEQD 246
            ...:...|..::::|..:.|.||:.|.....     :|..:.|                |..|||
  Fly   139 SWPKNNNVKPQVKKESFVWHKKQKLQPSQITSLVSKREPEIKD----------------EPAEQD 187

  Fly   247 N------ESSGEYTVNIQCPSCPEKFSSRRAYNVHTKREHFPG---YVCDQCGKTLQSYSGFIGH 302
            .      :.:|..::   |..|.|||.|:...:.|....|.|.   |:|:.|.:|..:.|....|
  Fly   188 TSLKGPPKKAGRKSI---CSVCGEKFLSKELADEHKSLVHVPSIPRYICNACNQTHHNQSDIRAH 249

  Fly   303 LQNHEPVK-QFACPVCPERFSRKFRLKHHMAWHSGETPYQ-------CDVCSKRFV-------HK 352
            ...|:..| .:.||:|....:..:....|:..|:..||.|       |.:|.|.||       |:
  Fly   250 QLWHKLSKTPYKCPLCESSVANAYAFTRHLREHTPPTPVQLLVLDRECPLCKKTFVTNFFYNTHR 314

  Fly   353 VALYKHKMIHDSETKRLECQVCGFKTRTKAHLERHMRSHTGDKPFACPVCNKRFSQMYNMKAHL 416
            .|:.|.|           |..|.....|:|...||           .|.|.|.:   .|...|:
  Fly   315 CAIRKRK-----------CGGCSRTLNTEAAYMRH-----------APTCPKIY---LNHSKHI 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 4/19 (21%)
zf-H2C2_2 327..351 CDD:290200 10/37 (27%)
C2H2 Zn finger 342..391 CDD:275368 15/55 (27%)
zf-H2C2_2 383..408 CDD:290200 5/24 (21%)
C2H2 Zn finger 399..419 CDD:275368 5/18 (28%)
C2H2 Zn finger 432..449 CDD:275368
CG1647NP_651636.1 zf-AD 19..99 CDD:285071 18/114 (16%)
C2H2 Zn finger 203..224 CDD:275368 7/20 (35%)
C2H2 Zn finger 233..253 CDD:275368 5/19 (26%)
C2H2 Zn finger 262..282 CDD:275368 4/19 (21%)
C2H2 Zn finger 297..314 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.