DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZIPIC and CG4730

DIOPT Version :9

Sequence 1:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001262965.1 Gene:CG4730 / 43099 FlyBaseID:FBgn0039355 Length:392 Species:Drosophila melanogaster


Alignment Length:477 Identity:95/477 - (19%)
Similarity:156/477 - (32%) Gaps:152/477 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NCCICQFSVRVPKDIHTDTVGHPPVLISELVLQ-------CTR-GTNYVLTEESSTICKKCCEKL 58
            |||........|..:...||    :...|..|.       ||: ........|..|:||:|..:|
  Fly    45 NCCRLCLEEPYPNQMLDMTV----IYDQEAALSYYDCYEICTKEDLRQNPKNEPRTLCKRCAVEL 105

  Fly    59 A---RYHKSIQIARKLRGEILELIHSPYMSKDHKQTSYKEDDLDRETTISKFDGNIEEAQQQDEE 120
            .   .:||.:.||.:...||.                                            
  Fly   106 KWAYDFHKKMAIANQQLREIF-------------------------------------------- 126

  Fly   121 EQELESVGTTVTLVGPAGIVEEVAEEEHTFIIKQSEEEDEFHSVDLELDIDNEIIINEEEAHEVE 185
                                  ||.|.:|      |:||:....:.|.|::.|.::  ||..|.:
  Fly   127 ----------------------VATEANT------EQEDDVEDEENEADMNEEFLM--EEIEEKQ 161

  Fly   186 EVAHEIEEVAHEIEEEDLLPHDKQEAQEEDFFKEDTMSDFDEHLDGAIEYIISDGEDQEQDNESS 250
            |.  .|:.:      ||::|.::...:....|   ...:|..|...|...:|....         
  Fly   162 ET--PIDSL------EDIVPRNRHTGKSNCKF---CHKEFRNHSRMAKHQMIHLAN--------- 206

  Fly   251 GEYTVNIQCPSCPEKFSSRRAYNVHTKREH-FPGYVCDQCGKTLQSYSGFIGHLQNHEPVKQFAC 314
               ..|.:|..|...:.:::|..||...:| ..|..||.|||.                      
  Fly   207 ---RPNFRCSQCDRVYLTKQALKVHVDSKHRQSGVHCDTCGKV---------------------- 246

  Fly   315 PVCPERFSRKFRLKHHMAWHSGETPYQCDVCSKRFVHKVALYKHKMIHDSETKRLECQV--CGFK 377
                  |:....|:.|..:|:.:.||.||:|.:||..:..|..|:.:..|.: |..|:.  |...
  Fly   247 ------FAIAKALEIHKRYHNRDFPYSCDLCDRRFAQRSHLTVHQQVKHSGS-RFICEFPGCQKS 304

  Fly   378 TRTKAHLERHMRSHTGDKPFACPVCNKRFSQMYNMKAHL-REH----ESPGTNRHRRFHC--SKC 435
            ..:.:.|..|..:||. .||.|..|::.:.....::.|| |:|    :.......|:||.  ||.
  Fly   305 FTSSSSLRNHECTHTA-MPFECAHCHQSYPARNKLRMHLERKHNMVVQMEDLEEMRKFHIVRSKL 368

  Fly   436 THTFINEQNYDAHVQRDDCTPV 457
            ....|.....::|..::|...:
  Fly   369 VMAKIYSDQKESHHAKNDSAAI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 3/19 (16%)
zf-H2C2_2 327..351 CDD:290200 10/23 (43%)
C2H2 Zn finger 342..391 CDD:275368 13/50 (26%)
zf-H2C2_2 383..408 CDD:290200 8/24 (33%)
C2H2 Zn finger 399..419 CDD:275368 5/20 (25%)
C2H2 Zn finger 432..449 CDD:275368 3/18 (17%)
CG4730NP_001262965.1 zf-AD 46..124 CDD:285071 19/81 (23%)
C2H2 Zn finger 183..203 CDD:275368 4/22 (18%)
C2H2 Zn finger 212..232 CDD:275368 5/19 (26%)
C2H2 Zn finger 240..260 CDD:275368 8/47 (17%)
C2H2 Zn finger 268..289 CDD:275368 7/20 (35%)
C2H2 Zn finger 296..318 CDD:275368 4/21 (19%)
C2H2 Zn finger 325..346 CDD:275368 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.