DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZIPIC and CG14667

DIOPT Version :9

Sequence 1:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001014607.1 Gene:CG14667 / 40643 FlyBaseID:FBgn0037317 Length:337 Species:Drosophila melanogaster


Alignment Length:423 Identity:82/423 - (19%)
Similarity:138/423 - (32%) Gaps:135/423 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ICKKCCEKLARYHKSIQIARKLRGEIL---------ELIHSPYMSKDHKQTSYKEDDLD---RET 102
            :|:.|..|:..:.:...|...:||:.|         ||..:..:.:...:..:.|.||.   ||.
  Fly     6 VCRICANKIMGHQRDRNIFIHMRGKYLGQLKLITGVELTRNQGLPEIVCERCFSELDLATKFRER 70

  Fly   103 TISKFDGN-----IEEAQQQDEEEQELESVGTTVTLVGPAGIVEEVAEEEHTFIIKQSEEEDEFH 162
            .|  |...     |::...|.....||.|......|:....:.....::::.......||..:..
  Fly    71 CI--FSQKYLLDIIKKTSDQSTVHVELSSEPLDEQLIDADQLETHYDDDQYVCYQGTKEEHQDLE 133

  Fly   163 SVDLELDIDNEIIINEEEAHEVEEVAHEIEEVAHEIEEEDLLPHDKQEAQEEDFFKEDTMSDFDE 227
            .::|:.|....:|...|.|.|.                          ||:||.           
  Fly   134 EIELDDDPSAAVIAAAEAAAEA--------------------------AQQEDL----------- 161

  Fly   228 HLDGAIEYIISDGEDQEQDNESSGEYTVNIQCPSCPEKFSSRRAYNVHTKREHFPGYVCDQCGKT 292
                           |||:.|.:.:                        :|.:|  ::||:||..
  Fly   162 ---------------QEQEMERAAK------------------------RRSNF--FICDECGTL 185

  Fly   293 LQSYSGFIGHLQNHEPVKQ----FACPVCPERFSRKFRLKHHMAW-HSGETPYQCDVCSKRFVHK 352
            ......:..||..|:..:.    |.||.||:.|::|..||.|... |.....:||.:|.:.|.. 
  Fly   186 FHDAFLYTEHLNGHQNRRDMNQFFPCPECPQTFNKKALLKQHRTQVHLINRRFQCTICHEAFAS- 249

  Fly   353 VALYKHKMIHDSETKRLECQVCGFKTRTKAHLERHMRSHTGDKPFACPVCNKRFSQMYNMKAHLR 417
                                 .|.|.       ||.::|..::|:.|..|...||.:..::.|..
  Fly   250 ---------------------LGAKL-------RHDKAHKNERPYPCLECGMIFSSVSELQNHFS 286

  Fly   418 EHESPGTNRHRRFHCSKCTHTFINEQNYDAHVQ 450
            .|    :.:.|:|.|..|...||..:...||.:
  Fly   287 TH----SKQIRKFRCEPCNMDFITRRGLVAHTK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..334 CDD:275368 9/20 (45%)
zf-H2C2_2 327..351 CDD:290200 8/24 (33%)
C2H2 Zn finger 342..391 CDD:275368 7/48 (15%)
zf-H2C2_2 383..408 CDD:290200 7/24 (29%)
C2H2 Zn finger 399..419 CDD:275368 5/19 (26%)
C2H2 Zn finger 432..449 CDD:275368 5/16 (31%)
CG14667NP_001014607.1 zf-AD 6..80 CDD:214871 16/75 (21%)
C2H2 Zn finger 179..199 CDD:275368 6/19 (32%)
C2H2 Zn finger 211..232 CDD:275368 9/20 (45%)
C2H2 Zn finger 240..260 CDD:275368 7/48 (15%)
zf-C2H2_8 243..313 CDD:292531 20/102 (20%)
C2H2 Zn finger 268..288 CDD:275368 5/19 (26%)
C2H2 Zn finger 297..316 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.