DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZIPIC and MTF-1

DIOPT Version :9

Sequence 1:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001097560.1 Gene:MTF-1 / 39089 FlyBaseID:FBgn0040305 Length:1006 Species:Drosophila melanogaster


Alignment Length:286 Identity:86/286 - (30%)
Similarity:134/286 - (46%) Gaps:50/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 EAHEVEEVAHEIEE-VAH-EIEEEDLLPHDKQEAQEEDFFKEDTMSDFDEHLDGAIEYIISDGED 242
            |..|.|::||.|:. |.| :::||::      |.|:|:          |:.:  |:.|       
  Fly   280 EPDEDEQLAHCIQPGVLHQDVDEEEV------ERQDEN----------DQLM--ALAY------- 319

  Fly   243 QEQDNESSGEYTVNIQCPSCPEKFSSRRAYNVHTKREHFPGY--VC--DQCGKT-LQSYSGFIGH 302
             |..:|:...|..|.:  :|...:|:......|.| .|...|  .|  |.|.|. |.|||..| |
  Fly   320 -ESSDEALSRYRCNYE--NCYRSYSTIGNLRTHLK-THTGDYSFKCPEDGCHKAFLTSYSLKI-H 379

  Fly   303 LQNHEPVKQFACPV--CPERFSRKFRLKHHMAWHSGETPYQCDVCSKRFVHKVALYKHKMIHDSE 365
            ::.|..||.:.|.|  |.:.|:.::||..|:..|:||| :.|::|.|.|.....|.||...|..|
  Fly   380 VRVHTKVKPYECEVSGCDKAFNTRYRLHAHLRLHNGET-FNCELCQKCFTTLSDLKKHMRTHTQE 443

  Fly   366 TKRLEC--QVCGFKTRTKAHLERHMRSHTGDKPFAC--PVCNKRFSQMYNMKAHLREHESPGTNR 426
             :..:|  ..||.......||:.|.|:|||:||:.|  ..|.|.||..:::|:|.:.|:....|:
  Fly   444 -RPYKCPEDDCGKAFTASHHLKTHRRTHTGEKPYPCQEDSCQKSFSTSHSLKSHKKTHQRQLQNK 507

  Fly   427 HRRFHCSKCTHTFINEQNYDAHVQRD 452
            .|:....|...|..::|.     |:|
  Fly   508 GRKKRPLKTQQTKCSDQE-----QKD 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 10/22 (45%)
C2H2 Zn finger 314..334 CDD:275368 7/21 (33%)
zf-H2C2_2 327..351 CDD:290200 10/23 (43%)
C2H2 Zn finger 342..391 CDD:275368 16/50 (32%)
zf-H2C2_2 383..408 CDD:290200 13/26 (50%)
C2H2 Zn finger 399..419 CDD:275368 7/21 (33%)
C2H2 Zn finger 432..449 CDD:275368 3/16 (19%)
MTF-1NP_001097560.1 zf-C2H2_aberr 329..471 CDD:293622 48/147 (33%)
C2H2 Zn finger 331..353 CDD:275368 5/24 (21%)
zf-H2C2_2 345..372 CDD:290200 8/27 (30%)
C2H2 Zn finger 361..383 CDD:275368 10/22 (45%)
zf-H2C2_2 375..402 CDD:290200 10/27 (37%)
C2H2 Zn finger 391..413 CDD:275368 7/21 (33%)
zf-C2H2 418..440 CDD:278523 7/21 (33%)
C2H2 Zn finger 420..440 CDD:275368 7/19 (37%)
zf-H2C2_2 432..458 CDD:290200 8/26 (31%)
COG5048 442..>519 CDD:227381 24/77 (31%)
C2H2 Zn finger 448..470 CDD:275368 7/21 (33%)
zf-H2C2_2 462..489 CDD:290200 13/26 (50%)
C2H2 Zn finger 478..500 CDD:275368 7/21 (33%)
DUF3682 862..>931 CDD:289231
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457148
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.