DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZIPIC and Blimp-1

DIOPT Version :9

Sequence 1:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001261442.1 Gene:Blimp-1 / 38638 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster


Alignment Length:181 Identity:56/181 - (30%)
Similarity:90/181 - (49%) Gaps:13/181 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 GYVCDQCGKTL-------QSYSGFIGHLQNHEPVKQFACPVCPERFSRKFRLKHHMAWHSGETPY 340
            |..|.:.|..|       :.|......|:..:....:.|.||.:.|.:...||.|:..||||.|:
  Fly   854 GNSCPRSGSPLSPNSLASRGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPF 918

  Fly   341 QCDVCSKRFVHKVALYKHKMIHDSETKRLECQVCGFKTRTKAHLERHMRSHTGDKPFACPVCNKR 405
            :|:||:|.|.....|.||.::|..| |..:|.:|..:..:.::|:.|:|.|:|.||:||.:|.::
  Fly   919 KCNVCTKSFTQLAHLQKHHLVHTGE-KPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDLCPQK 982

  Fly   406 FSQMYNMKAHLREHESPGTNRHRRFHCSKCTHTFINEQNYDAHVQRDDCTP 456
            |:|..::|.|.|.|    || .|.:.|..|...:|:......|.:...|.|
  Fly   983 FTQFVHLKLHKRLH----TN-DRPYVCQGCDKKYISASGLRTHWKTTSCKP 1028

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 5/26 (19%)
C2H2 Zn finger 314..334 CDD:275368 7/19 (37%)
zf-H2C2_2 327..351 CDD:290200 13/23 (57%)
C2H2 Zn finger 342..391 CDD:275368 16/48 (33%)
zf-H2C2_2 383..408 CDD:290200 11/24 (46%)
C2H2 Zn finger 399..419 CDD:275368 7/19 (37%)
C2H2 Zn finger 432..449 CDD:275368 3/16 (19%)
Blimp-1NP_001261442.1 SET 133..260 CDD:214614
C2H2 Zn finger 892..912 CDD:275368 7/19 (37%)
zf-H2C2_2 904..929 CDD:290200 13/24 (54%)
C2H2 Zn finger 920..940 CDD:275368 8/19 (42%)
zf-H2C2_2 932..957 CDD:290200 8/25 (32%)
C2H2 Zn finger 948..968 CDD:275368 5/19 (26%)
zf-H2C2_2 960..985 CDD:290200 11/24 (46%)
C2H2 Zn finger 976..996 CDD:275368 7/19 (37%)
C2H2 Zn finger 1004..1023 CDD:275368 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457163
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.