DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZIPIC and Kah

DIOPT Version :9

Sequence 1:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster


Alignment Length:156 Identity:45/156 - (28%)
Similarity:67/156 - (42%) Gaps:33/156 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 YVCDQCGKTLQSYSGFIGHLQNHEPVKQFACPVCPERFSRKFRLKHHMAWHSGETPYQCDVCSKR 348
            ::|.:|||...:.|....|.|.|..:           ..:|.|              .|..|.|.
  Fly   119 HICPECGKKYSTSSNLARHRQTHRSI-----------MDKKAR--------------HCPYCEKV 158

  Fly   349 FVHKVALYKHKMIHDSETKRLECQVCGFKTRTKAHLERHMRSHTGDKPFACPVCNKRFSQMYNMK 413
            :|...|...|...|:   :..|||.||.:......|:.|:|:|||:|||.|.||.|.|:...|::
  Fly   159 YVSMPAYSMHVRTHN---QGCECQFCGKRFSRPWLLQGHIRTHTGEKPFKCGVCEKAFADKSNLR 220

  Fly   414 AHLREHESPGTNRHRRFHCSKCTHTF 439
            ||::.|.:  |..|.   |::|...|
  Fly   221 AHIQTHSN--TKPHT---CARCGKAF 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 7/19 (37%)
C2H2 Zn finger 314..334 CDD:275368 2/19 (11%)
zf-H2C2_2 327..351 CDD:290200 3/23 (13%)
C2H2 Zn finger 342..391 CDD:275368 15/48 (31%)
zf-H2C2_2 383..408 CDD:290200 14/24 (58%)
C2H2 Zn finger 399..419 CDD:275368 8/19 (42%)
C2H2 Zn finger 432..449 CDD:275368 3/8 (38%)
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 7/21 (33%)
C2H2 Zn finger 121..141 CDD:275368 7/19 (37%)
zf-C2H2 176..198 CDD:278523 8/21 (38%)
C2H2 Zn finger 178..198 CDD:275368 7/19 (37%)
zf-H2C2_2 191..214 CDD:290200 13/22 (59%)
zf-C2H2 204..226 CDD:278523 9/21 (43%)
C2H2 Zn finger 206..226 CDD:275368 8/19 (42%)
zf-H2C2_2 218..242 CDD:290200 9/29 (31%)
C2H2 Zn finger 234..250 CDD:275368 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457115
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.