DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZIPIC and CG11906

DIOPT Version :9

Sequence 1:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_611402.2 Gene:CG11906 / 37209 FlyBaseID:FBgn0034425 Length:634 Species:Drosophila melanogaster


Alignment Length:409 Identity:87/409 - (21%)
Similarity:135/409 - (33%) Gaps:122/409 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 QTSYKED-----------------DLDRETTISK-----------FDGNIEEAQQQDEEEQELES 126
            :.||.|:                 |.:.||.|||           :..::.|||...:.|.|:..
  Fly   241 EASYDEEAPSRAIRSSRIYYCRHCDAEFETLISKRQHERMKHQQRYPCDLCEAQLDTKYEWEMHH 305

  Fly   127 VGTTVTLVGPAGIVEEVAEEEHTFIIKQ--------------SEEEDEFHSVDLELDIDNEIIIN 177
              |.......|..:.|..|...|.:..:              ||..|.:       |:|      
  Fly   306 --TICQAKQEALAIVEQQEAGQTVMTSRVPRACSMRSRSRACSEAWDRY-------DMD------ 355

  Fly   178 EEEAHEVEEVAHEIEEVAHEIEEEDLLPHDKQEAQEEDFFKEDTM--SDFDEHLDGAIEYIISDG 240
            |||..|.:|   |||....|:||.:   .|...|:..:|..:..:  |..:.:..|.:..:..|.
  Fly   356 EEEEDEEDE---EIESGGEELEEGE---EDAMYARRMNFTGDWIVNHSRSNSNSAGNLSLLYGDY 414

  Fly   241 EDQEQDNESSGEYTV-------------NIQC--PSCPEKFSSRRAYNVHTKREHF--PGYVCDQ 288
            ...|....:..||.:             :..|  |.|..:..:..|...|...||:  ..:.|.:
  Fly   415 GMVETHMTTDKEYDLYLLDLLKTQVRLKSFTCFTPDCGYQTDTLVALMKHDYMEHWKMSWFYCHK 479

  Fly   289 CGKTLQS--YSGFIGHLQNHEPVKQFACPVCPERFSRKFRLKHHMAWHSGETPYQCDVCSKRFVH 351
            ||....|  :..:..||||.   ..:.|..|.|.|..:.:|..|...|.....|.|:.|...|:.
  Fly   480 CGDVFTSKVFLDYHMHLQNR---GLYICHKCREEFELQHQLDRHFQLHRKGINYHCNFCRLEFLS 541

  Fly   352 KVALYKH--KMIH----------DSETKRLECQV---CGFKTRTKAHLER--------------- 386
            :..|..|  |:.|          |.....:.|.|   ..:....|::.||               
  Fly   542 EAKLLAHCKKLGHSPNDEPLISIDRSLSIVNCHVPRSSDYSRIVKSYEEREFYIPRIPMPSTQPM 606

  Fly   387 HMRSHTGDKP--FACPVCN 403
            |:..|   ||  ||..:|:
  Fly   607 HLPQH---KPFRFAIGICD 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 7/21 (33%)
C2H2 Zn finger 314..334 CDD:275368 6/19 (32%)
zf-H2C2_2 327..351 CDD:290200 7/23 (30%)
C2H2 Zn finger 342..391 CDD:275368 14/78 (18%)
zf-H2C2_2 383..408 CDD:290200 9/38 (24%)
C2H2 Zn finger 399..419 CDD:275368 1/5 (20%)
C2H2 Zn finger 432..449 CDD:275368
CG11906NP_611402.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468403
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.