DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZIPIC and CG1603

DIOPT Version :9

Sequence 1:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001260778.1 Gene:CG1603 / 35683 FlyBaseID:FBgn0033185 Length:586 Species:Drosophila melanogaster


Alignment Length:455 Identity:88/455 - (19%)
Similarity:163/455 - (35%) Gaps:116/455 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PKDIHTDTVGHPPVLISELVLQCTRGTNYVLTEESSTICKKCCEKL-ARYHKSIQIARKLRGEIL 76
            |.|.|........:....::.:..|..|.:.|.|.   .||..|:| .:|  ::.:..|.||:::
  Fly   215 PSDEHYQDEPARSMAYEAIMERMDRKANVLFTVEE---LKKTLEQLHVQY--TLALETKQRGKLV 274

  Fly    77 ELIHSPYMSKDH-----KQTSYKEDDLDRETTISKFDGNIEEAQQQDEEEQELESVGTTVTLVGP 136
            .|. :.|.:|..     ...:.:|::.|.:.|..|.  |.:|           |::.||      
  Fly   275 GLA-ARYFAKCEFLSVAPVVTPRENEEDNDLTAIKL--NFKE-----------ENLITT------ 319

  Fly   137 AGIVEEVAEEEHTFIIKQSEEEDEFHSVDLELD--------IDNEIIINEEEAH-EVEEVAHEIE 192
             ..:|..|    .:.:..::...:|.|:::..|        ....:..||.:.: .|.::...:.
  Fly   320 -SFIETYA----NYPVLYNQALPDFGSIEIRADAFKRMAKEFQPVVKANETDVYIAVNKLRRWLY 379

  Fly   193 EVAHEIEEEDLLPH-DKQEAQEEDFFKEDTMSDFDEHLDGAIEYIISDGEDQEQDNESSGEYTVN 256
            :....::.::|:.. .|||.|               :|. ...::.:.|.:.:.           
  Fly   380 DAIRRLKSKELIQKCSKQEVQ---------------YLQ-MCSFLPAKGSESQV----------- 417

  Fly   257 IQCPSCPEKFSSRRAYNVHTKREHFPGYVCDQCGKTLQSYSGFIGHLQNHEPVKQFACPVCPERF 321
            :.|..|.::|.......||..:.|                  .:|.|       .:.|..||.||
  Fly   418 LYCDYCDKRFHGDYNLRVHIVKAH------------------EVGDL-------PYLCSFCPRRF 457

  Fly   322 SRKFRLKHHMAWHSGETPYQCDVCSKRFVHKVALYKHKMIHDSETKRLECQVCGFKTRTKAHLER 386
            .|...:..|......|...:|..|.|.|.....|..|.:||..|...: |.:||...|.|..|:.
  Fly   458 DRHVDMDRHKLRSHFERKLKCQYCEKSFAVDTDLKVHTLIHTGERPHV-CDICGKTFRLKLLLDH 521

  Fly   387 HMRS-HTGDKPFACPVCNKRFSQMYNMKAHLREH----------------ESPGTNRHRRFHCSK 434
            |:.. |...:|::|.:|.|.|.:.:.:..|::.|                :....:||||.|.|:
  Fly   522 HVNGVHLNIRPYSCNMCTKTFRKKFELANHIKGHLNIRDKKCEYCDATFYDHSSLSRHRRSHRSE 586

  Fly   435  434
              Fly   587  586

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 2/19 (11%)
C2H2 Zn finger 314..334 CDD:275368 7/19 (37%)
zf-H2C2_2 327..351 CDD:290200 6/23 (26%)
C2H2 Zn finger 342..391 CDD:275368 16/49 (33%)
zf-H2C2_2 383..408 CDD:290200 8/25 (32%)
C2H2 Zn finger 399..419 CDD:275368 5/19 (26%)
C2H2 Zn finger 432..449 CDD:275368 1/3 (33%)
CG1603NP_001260778.1 MADF_DNA_bdg 202..287 CDD:287510 18/77 (23%)
GT1 321..408 CDD:304916 14/106 (13%)
C2H2 Zn finger 420..441 CDD:275368 5/20 (25%)
COG5048 <424..583 CDD:227381 42/184 (23%)
C2H2 Zn finger 450..471 CDD:275368 7/20 (35%)
C2H2 Zn finger 478..498 CDD:275368 6/19 (32%)
zf-H2C2_2 490..513 CDD:290200 8/23 (35%)
C2H2 Zn finger 506..527 CDD:275368 7/20 (35%)
C2H2 Zn finger 535..555 CDD:275368 5/19 (26%)
C2H2 Zn finger 563..583 CDD:275368 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457180
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.