DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZIPIC and CG10431

DIOPT Version :9

Sequence 1:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001286078.1 Gene:CG10431 / 35157 FlyBaseID:FBgn0032730 Length:762 Species:Drosophila melanogaster


Alignment Length:205 Identity:52/205 - (25%)
Similarity:87/205 - (42%) Gaps:41/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 CPSCPEKFSSRRAYNVHTKRE-HF----PGYV--CDQCGKTLQSYSGFIGH---------LQNHE 307
            |..|.:.||..:..:.|.::: ||    |.:.  |..|.|..:|..|...|         |:||.
  Fly   558 CRMCRKGFSKFKNLHHHRRQKAHFVKLIPNFSGRCSGCLKFFRSRLGLRQHMRYICQSLSLKNHR 622

  Fly   308 PVKQFACPVCPE------RFSRKFRL---------KHHMAWHSGE--TP---YQCDVCSKRFVHK 352
            .::.|.|..|..      |..|:..|         |...|.:|.:  ||   ::|::|.|.|...
  Fly   623 RLQSFKCRHCQAIAFAHWRLYRRHELNCRPKKSKTKVQTAMNSKKKVTPTQVFECNICKKSFGSL 687

  Fly   353 VALYKHKMIHDSETKRLECQVCGFKTRTKAHLERHMRS-HTGDKPFACPVCNKRFS---QMYNMK 413
            ..|.:|.:.|.:| ::.:|.:|....:.:..|.:|::. |...||..||||..|::   .|...:
  Fly   688 NGLRQHNITHSTE-RQHKCGICERVFKRRNGLSQHIKGYHLQLKPHECPVCQHRYALKCDMLRCR 751

  Fly   414 AHLREHESPG 423
            ..||:..:.|
  Fly   752 HSLRKGPAAG 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 7/28 (25%)
C2H2 Zn finger 314..334 CDD:275368 7/34 (21%)
zf-H2C2_2 327..351 CDD:290200 10/37 (27%)
C2H2 Zn finger 342..391 CDD:275368 12/49 (24%)
zf-H2C2_2 383..408 CDD:290200 10/28 (36%)
C2H2 Zn finger 399..419 CDD:275368 8/22 (36%)
C2H2 Zn finger 432..449 CDD:275368
CG10431NP_001286078.1 THAP 4..81 CDD:283206
zf-AD 123..192 CDD:214871
zf-C2H2_6 674..700 CDD:290623 7/25 (28%)
C2H2 Zn finger 677..697 CDD:275368 6/19 (32%)
C2H2 Zn finger 705..726 CDD:275368 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.