Sequence 1: | NP_651765.1 | Gene: | ZIPIC / 43566 | FlyBaseID: | FBgn0039740 | Length: | 457 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_476732.1 | Gene: | sna / 34908 | FlyBaseID: | FBgn0003448 | Length: | 390 | Species: | Drosophila melanogaster |
Alignment Length: | 206 | Identity: | 52/206 - (25%) |
---|---|---|---|
Similarity: | 83/206 - (40%) | Gaps: | 64/206 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 249 SSGEYTVN------IQCPSCPEKFSSRRAYNVHTKREHFPG---------YVCDQCGKTLQSYSG 298
Fly 299 FIGHLQNHE-PVKQFACPVCPERFSRKFRLKHHMAWHSGETPYQCDVCSKRFVHKVALYKHKMIH 362
Fly 363 DSETKRLECQVCGFKTRTKAHLERHMRSHTGDKPFACPVCNKRFSQMYNMKAHLREHESPGTNRH 427
Fly 428 RRFHCSKCTHT 438 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ZIPIC | NP_651765.1 | C2H2 Zn finger | 286..306 | CDD:275368 | 5/19 (26%) |
C2H2 Zn finger | 314..334 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 327..351 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 342..391 | CDD:275368 | 5/48 (10%) | ||
zf-H2C2_2 | 383..408 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 399..419 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 432..449 | CDD:275368 | 4/7 (57%) | ||
sna | NP_476732.1 | C2H2 Zn finger | 308..328 | CDD:275368 | 8/19 (42%) |
zf-H2C2_2 | 321..344 | CDD:290200 | 9/22 (41%) | ||
zf-C2H2 | 334..356 | CDD:278523 | 6/50 (12%) | ||
C2H2 Zn finger | 336..356 | CDD:275368 | 5/48 (10%) | ||
zf-H2C2_2 | 348..373 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 364..380 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 247..267 | CDD:275368 | 4/20 (20%) | ||
C2H2 Zn finger | 282..302 | CDD:275368 | 5/19 (26%) | ||
zf-C2H2 | 306..328 | CDD:278523 | 9/24 (38%) | ||
COG5048 | 307..>356 | CDD:227381 | 19/80 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45468419 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |