DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZIPIC and sna

DIOPT Version :9

Sequence 1:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_476732.1 Gene:sna / 34908 FlyBaseID:FBgn0003448 Length:390 Species:Drosophila melanogaster


Alignment Length:206 Identity:52/206 - (25%)
Similarity:83/206 - (40%) Gaps:64/206 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 SSGEYTVN------IQCPSCPEKFSSRRAYNVHTKREHFPG---------YVCDQCGKTLQSYSG 298
            ||.....|      .:|..|.:.:|:....:.| ::.|.|.         :.|::|||...:...
  Fly   231 SSASVAANHAKNYRFKCDECQKMYSTSMGLSKH-RQFHCPAAECNQEKKTHSCEECGKLYTTIGA 294

  Fly   299 FIGHLQNHE-PVKQFACPVCPERFSRKFRLKHHMAWHSGETPYQCDVCSKRFVHKVALYKHKMIH 362
            ...|::.|. |.|   ||:|.:.|||.:.|:.|:..|:||.|:||..|.:.|.            
  Fly   295 LKMHIRTHTLPCK---CPICGKAFSRPWLLQGHIRTHTGEKPFQCPDCPRSFA------------ 344

  Fly   363 DSETKRLECQVCGFKTRTKAHLERHMRSHTGDKPFACPVCNKRFSQMYNMKAHLREHESPGTNRH 427
                             .:::|..|.::|...|.:||.||:|.||:|    :.|.:|.|      
  Fly   345 -----------------DRSNLRAHQQTHVDVKKYACQVCHKSFSRM----SLLNKHSS------ 382

  Fly   428 RRFHCSKCTHT 438
                 |.||.|
  Fly   383 -----SNCTIT 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 8/19 (42%)
zf-H2C2_2 327..351 CDD:290200 10/23 (43%)
C2H2 Zn finger 342..391 CDD:275368 5/48 (10%)
zf-H2C2_2 383..408 CDD:290200 10/24 (42%)
C2H2 Zn finger 399..419 CDD:275368 8/19 (42%)
C2H2 Zn finger 432..449 CDD:275368 4/7 (57%)
snaNP_476732.1 C2H2 Zn finger 308..328 CDD:275368 8/19 (42%)
zf-H2C2_2 321..344 CDD:290200 9/22 (41%)
zf-C2H2 334..356 CDD:278523 6/50 (12%)
C2H2 Zn finger 336..356 CDD:275368 5/48 (10%)
zf-H2C2_2 348..373 CDD:290200 10/24 (42%)
C2H2 Zn finger 364..380 CDD:275368 8/19 (42%)
C2H2 Zn finger 247..267 CDD:275368 4/20 (20%)
C2H2 Zn finger 282..302 CDD:275368 5/19 (26%)
zf-C2H2 306..328 CDD:278523 9/24 (38%)
COG5048 307..>356 CDD:227381 19/80 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468419
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.