DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZIPIC and CG1529

DIOPT Version :9

Sequence 1:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster


Alignment Length:347 Identity:87/347 - (25%)
Similarity:142/347 - (40%) Gaps:45/347 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 PAGIVEEVAEEEHTFII----------KQSEEEDEFHSVDLELDIDNEIIINEEEAHEVEEVAHE 190
            |.|...|:....|..::          :.|::...:..||:.:|     .:.||...|..:..||
  Fly    47 PHGFPTEICNLCHNAVVYFDELRQVARESSQKLIGWQPVDIAVD-----RVKEEPPDEGLKENHE 106

  Fly   191 IEEVAHEIEEEDLLPHDKQ-EAQEEDFFK--EDTMSDFDEHLDGAIEYIISDGEDQEQDNESSG- 251
            ..|  ||:|||    |:|| :.|:.|..|  ||.....|:..|.  ||.......|:|.::.:| 
  Fly   107 ENE--HELEEE----HEKQADGQQVDLSKKQEDQKKILDDREDE--EYPDEYENSQQQLSQGTGS 163

  Fly   252 EYTVNIQCPSCPEKFSSRRAYNVHTKREHFPGY----VCDQCGKTLQSYSGFIGHLQNHEP---- 308
            :....:.|..|.::.........|.:..| .||    :|..|.|:...|.....|::|..|    
  Fly   164 KRRAGLACDQCGKQVYKLPYLEAHIRSVH-QGYSKPFLCRSCDKSFTRYEQLRSHMRNAHPQLEQ 227

  Fly   309 ----VKQFACPVCPERFSRKFRLKHHMAWHSGETPYQCDVCSKRFVHKVALYKHKMIHDSETKRL 369
                ::...|.:|..::|.|..|..|:..|:....:.|:.|....|.:..|..|...|:...:|.
  Fly   228 LQQELRDLICELCNRQYSTKNALGEHLKRHAQRKEHVCEHCGVAKVTRTELLTHLRTHNPTWERF 292

  Fly   370 ECQVCGFKTRTKAHLERHMR-SHTGDKPFACPVCNKRFSQMYNMKAHLREH-ESPGTNRHRR--- 429
            :|:.|....|.|:.:.||:| .|.|.:.|.|..|.|:|....:...|.|.| ||.|:.....   
  Fly   293 KCEQCPQLFRHKSAISRHVRVVHEGQRRFQCGHCEKKFGTHASQVRHERLHTESTGSGEAAEEWP 357

  Fly   430 FHCSKCTHTFINEQNYDAHVQR 451
            |.|..|....::.|..:.|::|
  Fly   358 FACIHCQKPCVSRQTLELHLRR 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 6/19 (32%)
zf-H2C2_2 327..351 CDD:290200 5/23 (22%)
C2H2 Zn finger 342..391 CDD:275368 14/49 (29%)
zf-H2C2_2 383..408 CDD:290200 10/25 (40%)
C2H2 Zn finger 399..419 CDD:275368 6/19 (32%)
C2H2 Zn finger 432..449 CDD:275368 3/16 (19%)
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071 5/31 (16%)
C2H2 Zn finger 171..192 CDD:275368 3/20 (15%)
zf-C2H2_2 201..>257 CDD:289522 13/55 (24%)
C2H2 Zn finger 201..222 CDD:275368 6/20 (30%)
C2H2 Zn finger 237..257 CDD:275368 6/19 (32%)
C2H2 Zn finger 265..285 CDD:275368 5/19 (26%)
zf-C2H2_8 268..349 CDD:292531 25/80 (31%)
C2H2 Zn finger 294..315 CDD:275368 7/20 (35%)
C2H2 Zn finger 323..343 CDD:275368 6/19 (32%)
C2H2 Zn finger 360..380 CDD:275368 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457189
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.