DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZIPIC and CG42726

DIOPT Version :9

Sequence 1:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster


Alignment Length:240 Identity:62/240 - (25%)
Similarity:112/240 - (46%) Gaps:18/240 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 MSDFDEHLDGAIEYIISDGEDQEQDNESSGEYTVNI-----QCPSCPEKFSSR--RAYNVHTKRE 279
            ::|..:.|:..:...:...|.||....:|.:..:.:     .|..|.:.|.||  :.|::....:
  Fly    32 VADVSDCLECRVARSVDIQETQETQARTSADKRIIVTDKGYHCTVCNKDFRSRTQQYYHLTCGND 96

  Fly   280 HFPGYVCDQCGKTLQSYSGFIGHLQNHEPVKQFACPVCPERFSRKFRLKHHMAWHSGETPYQCDV 344
            ....:.|.:||:...:.|....||.:||...:.:|.||.:.|.:...|:.||..|:.| .:.|.:
  Fly    97 LLKKFNCKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQE-KHLCPI 160

  Fly   345 CSKRFVHKVALYKHKMIHDSETKRLECQVCGFKTRTKAHLERHMRSHTGDK---PFACPVCNKRF 406
            |.|.|..|.:|..|..||.....:.:|::|....:.||:|.:|:|.|  ||   ...|.||.|.|
  Fly   161 CQKVFRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQHLRKH--DKNNIRHMCKVCQKSF 223

  Fly   407 SQMYNMKAHLREHESPGTNRHRRFHCSKCTHTFINEQNYDAHVQR 451
            .:...::.|::.|    :||.|: .||.|..::.:......|:::
  Fly   224 LRQTTLRLHMKRH----SNRERQ-SCSLCGKSYNDPDALGRHLRQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..334 CDD:275368 7/19 (37%)
zf-H2C2_2 327..351 CDD:290200 9/23 (39%)
C2H2 Zn finger 342..391 CDD:275368 16/48 (33%)
zf-H2C2_2 383..408 CDD:290200 11/27 (41%)
C2H2 Zn finger 399..419 CDD:275368 6/19 (32%)
C2H2 Zn finger 432..449 CDD:275368 3/16 (19%)
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368 6/19 (32%)
C2H2 Zn finger 103..123 CDD:275368 6/19 (32%)
COG5048 <112..288 CDD:227381 47/160 (29%)
C2H2 Zn finger 131..151 CDD:275368 7/19 (37%)
Chordopox_A33R 151..>254 CDD:283591 34/110 (31%)
C2H2 Zn finger 158..178 CDD:275368 7/19 (37%)
C2H2 Zn finger 187..207 CDD:275368 7/19 (37%)
C2H2 Zn finger 216..236 CDD:275368 6/19 (32%)
C2H2 Zn finger 244..264 CDD:275368 4/20 (20%)
C2H2 Zn finger 272..290 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468405
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.