DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ZIPIC and si:dkeyp-2e4.2

DIOPT Version :9

Sequence 1:NP_651765.1 Gene:ZIPIC / 43566 FlyBaseID:FBgn0039740 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001122042.1 Gene:si:dkeyp-2e4.2 / 100149164 ZFINID:ZDB-GENE-030131-9307 Length:251 Species:Danio rerio


Alignment Length:202 Identity:58/202 - (28%)
Similarity:95/202 - (47%) Gaps:34/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 DQEQDNESS----------------GEYTVNIQCPSCPEKFSSR----RAYNVHTKREHFPGYVC 286
            ||..|..||                ||   ::.|..|..:|.|.    |...:||..   ..|:|
Zfish    50 DQTSDQSSSDTDTEDELPISTSPTPGE---DLICKLCGSEFGSNISMVRHMRIHTGE---TPYIC 108

  Fly   287 DQCGKTLQSYSGFIGHLQNH-----EPVKQFACPVCPERFSRKFRLKHHMAWHSGETPYQCDVCS 346
            :.|||..:.......|.:.|     :..|:.:|..|..:|:....|:.|:..|.||.|:.|..|.
Zfish   109 EVCGKGFKRQGWLKEHFRVHTGNKRKREKRLSCDQCEMKFNSSTALRSHLNKHRGERPFACVQCD 173

  Fly   347 KRFVHKVALYKHKMIHDSET-KRLECQVCGFKTRTKAHLERHMRSHTGDKPFACPVCNKRFSQMY 410
            |.:.::..|.:|  :.|..: |:..|.:||.:...::.|::|||.|||::|::||.|.|.||..:
Zfish   174 KTYFNQHDLNQH--LRDCHSDKKHGCYLCGNEFTRQSSLQKHMRIHTGERPYSCPHCGKTFSYKH 236

  Fly   411 NMKAHLR 417
            :||.|::
Zfish   237 SMKMHVK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ZIPICNP_651765.1 C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
zf-H2C2_2 327..351 CDD:290200 9/23 (39%)
C2H2 Zn finger 342..391 CDD:275368 14/49 (29%)
zf-H2C2_2 383..408 CDD:290200 13/24 (54%)
C2H2 Zn finger 399..419 CDD:275368 9/19 (47%)
C2H2 Zn finger 432..449 CDD:275368
si:dkeyp-2e4.2NP_001122042.1 C2H2 Zn finger 80..100 CDD:275368 5/19 (26%)
zf-H2C2_2 92..117 CDD:290200 8/27 (30%)
C2H2 Zn finger 108..128 CDD:275368 5/19 (26%)
C2H2 Zn finger 141..161 CDD:275368 5/19 (26%)
C2H2 Zn finger 169..217 CDD:275368 14/49 (29%)
zf-H2C2_2 209..234 CDD:290200 13/24 (54%)
C2H2 Zn finger 225..243 CDD:275368 9/17 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24406
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.