DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Axn and RGS9

DIOPT Version :9

Sequence 1:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_003826.2 Gene:RGS9 / 8787 HGNCID:10004 Length:674 Species:Homo sapiens


Alignment Length:282 Identity:60/282 - (21%)
Similarity:105/282 - (37%) Gaps:71/282 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WARTLNHLLEDRDGVELFKKYVEEEAPAYNDHLNFYFACEGLKQQTDPEKIKQIIGAIYR-FL-- 112
            ||...:.|:.|..|.:.|:.::::|....|  |.|:.|||.|| ..|..|:|:....||: ||  
Human   299 WAFNFSELIRDPKGRQSFQYFLKKEFSGEN--LGFWEACEDLK-YGDQSKVKEKAEEIYKLFLAP 360

  Fly   113 -RKSQLSI-SDDLRAQIKAIKTNPEIPLSPH--IFDPMQRHVEVTIRDNIYPTFLCSEMY----- 168
             .:..::| ...:...:|.:|       .||  :.|..|.|:.:.::.:.|..:|.|.:|     
Human   361 GARRWINIDGKTMDITVKGLK-------HPHRYVLDAAQTHIYMLMKKDSYARYLKSPIYKDMLA 418

  Fly   169 ------------------------------ILYIQQMSAQQERCTSSGATGSGSAGSSGSGGSSL 203
                                          :..:::.:..:|...:...|..|...:.....:..
Human   419 KAIEPQETTKKSSTLPFMRRHLRSSPSPVILRQLEEEAKAREAANTVDITQPGQHMAPSPHLTVY 483

  Fly   204 AGACALP----PTTASGKQQLPQLVPPGAFINLPVSSVSGPP-------------AGTCSASGSV 251
            .|.|..|    |.::|.:........|..||..|.:::...|             .|.||.|.:.
Human   484 TGTCMPPSPSSPFSSSCRSPRKPFASPSRFIRRPSTTICPSPIRVALESSSGLEQKGECSGSMAP 548

  Fly   252 YGPSTSASSSGSISATDTLPRS 273
            .|||.:.||..|:..  :.|||
Human   549 RGPSVTESSEASLDT--SWPRS 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AxnNP_733336.1 RGS 55..170 CDD:295367 32/156 (21%)
Axin_b-cat_bind 494..543 CDD:285982
DIX 665..739 CDD:279160
RGS9NP_003826.2 DEP_RGS7-like 22..109 CDD:239897
GGL 224..283 CDD:128520
RGS_RGS9 295..415 CDD:188693 34/125 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 533..573 13/38 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.