DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Axn and RGS20

DIOPT Version :9

Sequence 1:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_733466.1 Gene:RGS20 / 8601 HGNCID:14600 Length:388 Species:Homo sapiens


Alignment Length:175 Identity:43/175 - (24%)
Similarity:76/175 - (43%) Gaps:21/175 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRKHDDNECSGPRPPVPGEESRVKKMT--EGVADTSKNSSPSYLNWARTLNHLLEDRDGVELFKK 70
            :|..:|.     ||.:...|.|....|  |..|.|.:..:.    ||::.:.|:....|...|::
Human   223 VRNQEDQ-----RPTIASHELRADLPTWEESPAPTLEEVNA----WAQSFDKLMVTPAGRNAFRE 278

  Fly    71 YVEEEAPAYNDHLNFYFACEGLKQQTDPEKIKQIIGAIYR----FLRKSQLSISDDLRAQIKAIK 131
            ::..|..  .:::.|:.|||.||::.:...|::....||.    .|...::|:...:|..|....
Human   279 FLRTEFS--EENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNM 341

  Fly   132 TNPEIPLSPHIFDPMQRHVEVTIRDNIYPTFLCSEMYILYIQQMS 176
            ..|    |.||||..|..:...:..:.||.|:.|.:|...:|.:|
Human   342 VEP----SQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLS 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AxnNP_733336.1 RGS 55..170 CDD:295367 29/118 (25%)
Axin_b-cat_bind 494..543 CDD:285982
DIX 665..739 CDD:279160
RGS20NP_733466.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..199
RGS_RGS20 221..376 CDD:188700 41/167 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.