DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Axn and SST2

DIOPT Version :9

Sequence 1:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_013557.1 Gene:SST2 / 851173 SGDID:S000004444 Length:698 Species:Saccharomyces cerevisiae


Alignment Length:175 Identity:41/175 - (23%)
Similarity:65/175 - (37%) Gaps:61/175 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EESRVKKMTEGVADTSKNSSPSYLNWARTLNHLLEDRDGVELFKKYVEEEAPAYNDHLNFYFACE 90
            :|.:....:||.:.....|| |.||   .|:::|.|.....||::::|:|....|  |:.:...:
Yeast   396 DEKKTLDDSEGFSQDMLISS-SNLN---KLDYVLTDPGMRYLFRRHLEKELCVEN--LDVFIEIK 454

  Fly    91 G-LKQQT----------------------------DPEKIKQ----------------IIGAIYR 110
            . ||:.|                            |...:||                :||:.| 
Yeast   455 RFLKKMTILKKLIDSKHCDKKSNTSTSKNNIVKTIDSALMKQANECLEMAYHIYSSYIMIGSPY- 518

  Fly   111 FLRKSQLSISDDLRAQIKAIKTNPEIPLSPH----IFDPMQRHVE 151
                 ||:|..:||..|..|..:|..|||.|    ::||.....|
Yeast   519 -----QLNIHHNLRQNISDIMLHPHSPLSEHFPTNLYDPSPASAE 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AxnNP_733336.1 RGS 55..170 CDD:295367 33/146 (23%)
Axin_b-cat_bind 494..543 CDD:285982
DIX 665..739 CDD:279160
SST2NP_013557.1 DEP 57..135 CDD:295306
DEP_RGS7-like 265..353 CDD:239897
RGS 420..>537 CDD:295367 25/124 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.