DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Axn and RGS4

DIOPT Version :9

Sequence 1:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_001095915.1 Gene:RGS4 / 5999 HGNCID:10000 Length:302 Species:Homo sapiens


Alignment Length:163 Identity:37/163 - (22%)
Similarity:67/163 - (41%) Gaps:21/163 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WARTLNHLLEDRDGVELFKKYVEEEAPAYN-DHLNFYFACEGLKQQTDPEKI----KQIIGAIYR 110
            ||.:|.:|:....|:..||.:::.|   |: ::::|:.:||..|:...|.|:    |:|......
Human   156 WAESLENLISHECGLAAFKAFLKSE---YSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS 217

  Fly   111 FLRKSQLSISDDLRAQIKAIKTNPEIPLSPHIFDPMQRHVEVTIRDNIYPTFLCSEMYILYIQQM 175
            .....::::....|.:.......|.|.    .||..|:.:...:..:.|..||.|..|:..:...
Human   218 VQATKEVNLDSCTREETSRNMLEPTIT----CFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPS 278

  Fly   176 SAQQERCTSSGATGSGSAGSSGSGGSSLAGACA 208
            |...|:  ..||..|...       :||...||
Human   279 SCGAEK--QKGAKSSADC-------ASLVPQCA 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AxnNP_733336.1 RGS 55..170 CDD:295367 26/119 (22%)
Axin_b-cat_bind 494..543 CDD:285982
DIX 665..739 CDD:279160
RGS4NP_001095915.1 RGS_RGS4 160..273 CDD:188669 26/119 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.