DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Axn and RGS1

DIOPT Version :10

Sequence 1:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_002913.3 Gene:RGS1 / 5996 HGNCID:9991 Length:209 Species:Homo sapiens


Alignment Length:166 Identity:43/166 - (25%)
Similarity:80/166 - (48%) Gaps:23/166 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RPPVPGEESRVKKMTEGVADTSKN--SSPSYLNWARTLNHLLEDRDGVELFKKYVEEEAPAYNDH 82
            |..:|..||.:|      :..||:  |:...:.|:::|..||.::.|..:|..:::.|..  .::
Human    55 RSMIPHLESGMK------SSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFS--EEN 111

  Fly    83 LNFYFACEGLKQ-QTD--PEKIKQIIGAIYRFLRKSQLSISDDLRAQ---IKAIKTNPEIPLSPH 141
            :.|:.|||..|: ::|  |.|.::|..|........|::|  |.|.:   .|.||..     :|.
Human   112 IEFWLACEDYKKTESDLLPCKAEEIYKAFVHSDAAKQINI--DFRTRESTAKKIKAP-----TPT 169

  Fly   142 IFDPMQRHVEVTIRDNIYPTFLCSEMYILYIQQMSA 177
            .||..|:.:...:..:.||.||.|::|:..:..:.|
Human   170 CFDEAQKVIYTLMEKDSYPRFLKSDIYLNLLNDLQA 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AxnNP_733336.1 RGS 55..170 CDD:470619 33/120 (28%)
Axin_b-cat_bind 495..530 CDD:462616
DIX 665..741 CDD:459936
RGS1NP_002913.3 RGS_RGS1 86..199 CDD:188670 33/121 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.