DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Axn and rgs16

DIOPT Version :9

Sequence 1:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_001017846.1 Gene:rgs16 / 569828 ZFINID:ZDB-GENE-050417-393 Length:208 Species:Danio rerio


Alignment Length:137 Identity:33/137 - (24%)
Similarity:60/137 - (43%) Gaps:10/137 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LNWARTLNHLLEDRDGVELFKKYVEEEAPAYNDHLNFYFACEGLKQQTDPEKIKQIIGAIY-RFL 112
            |.|..:|..||..:.|:..|:.::..|..  .:::.||.|||..|....|.|:......|| .|:
Zfish    59 LMWKVSLEKLLSSKHGLYAFRAFLVSEFS--EENIAFYLACEDYKNTKSPAKMPSKAKRIYEEFI 121

  Fly   113 RKS---QLSISDDLRAQIKAIKTNPEIPLSPHIFDPMQRHVEVTIRDNIYPTFLCSEMYILYIQQ 174
            ...   :::|..:.|...:|...:|    :...||..|..:.:.:..:.||.||.|..|...:.|
Zfish   122 GSEAPREVNIDYETRDITQANLQSP----TASCFDTAQYRIYILMEKDCYPRFLRSASYRNLLNQ 182

  Fly   175 MSAQQER 181
            ::.:..:
Zfish   183 LTMKSAK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AxnNP_733336.1 RGS 55..170 CDD:295367 30/118 (25%)
Axin_b-cat_bind 494..543 CDD:285982
DIX 665..739 CDD:279160
rgs16NP_001017846.1 RGS 65..178 CDD:295367 30/118 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.