DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Axn and si:ch211-152p11.4

DIOPT Version :9

Sequence 1:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster
Sequence 2:XP_021323824.1 Gene:si:ch211-152p11.4 / 555531 ZFINID:ZDB-GENE-060503-764 Length:322 Species:Danio rerio


Alignment Length:179 Identity:39/179 - (21%)
Similarity:71/179 - (39%) Gaps:29/179 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGHPSGIRKHDDNECSGPRPPVPGEESRVKK--------MTEGVADTSKNSSPSYLNWARTLNHL 58
            |.| :.:::|.:|..|       .:|.|.:|        :..|....|:....|   ||:.|..|
Zfish   153 SSH-TNLKEHRENVTS-------TKEKRSRKPFLRQWSQVGHGRGRLSRKEVES---WAKCLETL 206

  Fly    59 LEDRDGVELFKKYVEEEAPAYNDHLNFYFACEGLKQQTD----PEKIKQIIGAIYRFLRKSQLSI 119
            |..|.|..:|:.::..|..  .::|.|:.|||..|..::    ..:.|.|:..........::::
Zfish   207 LASRVGFSVFEAFLRSEFS--EENLQFHVACEQYKNSSNKFTLQRRAKMILETYIMQSSPREVNL 269

  Fly   120 SDDLRAQIKAIKTNPEIPLSPHIFDPMQRHVEVTIRDNIYPTFLCSEMY 168
            ....|...:.:...|......|    .|:.:...:..:.||.||.||:|
Zfish   270 DWKTRELTQTLLKAPSHTSLTH----AQKRIYGLLEMDSYPRFLQSEIY 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AxnNP_733336.1 RGS 55..170 CDD:295367 26/118 (22%)
Axin_b-cat_bind 494..543 CDD:285982
DIX 665..739 CDD:279160
si:ch211-152p11.4XP_021323824.1 RGS 203..314 CDD:321993 25/116 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.