DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Axn and Rgs6

DIOPT Version :9

Sequence 1:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster
Sequence 2:XP_038968710.1 Gene:Rgs6 / 54295 RGDID:3569 Length:552 Species:Rattus norvegicus


Alignment Length:380 Identity:67/380 - (17%)
Similarity:109/380 - (28%) Gaps:158/380 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PVPG----------------EESRVKKMTEGVADTSKNSSP--------------------SYLN 50
            ||||                ...:|||...||.|.|::.||                    ::||
  Rat   205 PVPGCVNTTEMDIRKCRRLKNPQKVKKSVYGVTDESQSQSPVHIPSQPIRKTTKDDIRKQITFLN 269

  Fly    51 ---------------------------------------------------------------WA 52
                                                                           |.
  Rat   270 AQIDRHCLKMSKVAESLIAYTEQYVEYDPFITPAEPSNPWISDDITLWDIEMSKEPSQQRVKRWG 334

  Fly    53 RTLNHLLEDRDGVELFKKYVEEEAPAYNDHLNFYFACEGLKQQTDPEKIKQIIGAIYRFLRKSQL 117
            .:.:.:|:|:.|.:.|.:::|.|..:.|  |.|:.|.:.||:|...:..|::......||.....
  Rat   335 FSFDEILKDQVGRDQFLRFLESEFSSEN--LRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAP 397

  Fly   118 SI----SDDLRAQIKAIKTNPEIPLSPHIFDPMQRHVEVTIRDNIYPTFLCSEMY---ILYIQQM 175
            |.    |.......:.:|..     ..:.|:..|.|:...::.:.|..||.|..|   :|..::.
  Rat   398 SAINLDSHSYEITSQNVKDG-----GRYTFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKP 457

  Fly   176 SAQQERCTSSGATGSGSAGSSGSGGSSLAGACALPPTTAS-----GKQQLPQLVPPGAFINLPVS 235
            .::|.|.||                        |...|.|     ..:......|.|.|:     
  Rat   458 ESEQGRRTS------------------------LEKFTRSVCCWRRLRMAAAFHPRGGFL----- 493

  Fly   236 SVSGPPAGTCSASGSVYGPSTSASSSGSISATDTLPRSSTLPTLHEDSVLSLCDD 290
                |..|..:...:.|||.       ::..|..:|.|...||.|.....|..:|
  Rat   494 ----PAVGKVAGGQAPYGPD-------AVLLTAPIPGSGPGPTEHPGRRRSTSND 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AxnNP_733336.1 RGS 55..170 CDD:295367 27/121 (22%)
Axin_b-cat_bind 494..543 CDD:285982
DIX 665..739 CDD:279160
Rgs6XP_038968710.1 DEP_RGS7-like 31..119 CDD:239897
RGS_DHEX 116..217 CDD:375589 4/11 (36%)
GGL 258..319 CDD:128520 2/60 (3%)
RGS_RGS6 328..452 CDD:188691 28/130 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.