DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Axn and Rgs10

DIOPT Version :9

Sequence 1:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_062210.1 Gene:Rgs10 / 54290 RGDID:3562 Length:181 Species:Rattus norvegicus


Alignment Length:159 Identity:41/159 - (25%)
Similarity:80/159 - (50%) Gaps:21/159 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SGPRPPVPGEESRVKKMTEGVADTSKNSSPSYLNWARTLNHLLEDRDGVELFKKYVEEEAPAYND 81
            |..|||....:.      :|.:.:|..|..|...||.:|.:||||.:||:.|::::::|..  .:
  Rat    10 SRKRPPSDIHDG------DGSSSSSHQSLKSTAKWASSLENLLEDPEGVKRFREFLKKEFS--EE 66

  Fly    82 HLNFYFACEGLKQQTDPEKIKQIIGAIY-RFL---RKSQLSISDDLRAQIKAIKTNPEIPLSPH- 141
            ::.|:.|||..|:..|.:::::....|| .||   ..||:::....|...|.::       .|| 
  Rat    67 NVLFWLACEDFKKTEDKKQMQEKAKKIYMTFLSNKASSQVNVEGQSRLTEKILE-------EPHP 124

  Fly   142 -IFDPMQRHVEVTIRDNIYPTFLCSEMYI 169
             :|..:|..:...::.:.|..||.|::::
  Rat   125 LMFQKLQDQIFNLMKYDSYSRFLKSDLFL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AxnNP_733336.1 RGS 55..170 CDD:295367 31/121 (26%)
Axin_b-cat_bind 494..543 CDD:285982
DIX 665..739 CDD:279160
Rgs10NP_062210.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 7/30 (23%)
RGS_RGS10 42..154 CDD:188695 31/121 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..181
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.