DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Axn and Rgs1

DIOPT Version :9

Sequence 1:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster
Sequence 2:XP_006250036.1 Gene:Rgs1 / 54289 RGDID:3561 Length:209 Species:Rattus norvegicus


Alignment Length:179 Identity:47/179 - (26%)
Similarity:84/179 - (46%) Gaps:21/179 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DDNECSGPRPPVPGEE------SRVKKMTEGV-ADTSKN--SSPSYLNWARTLNHLLEDRDGVEL 67
            |||: ...||...|.:      |.:..:..|: :..||:  |:...:.|:::|..||.::.|..:
  Rat    35 DDNK-QKKRPKTFGMDMKAYLRSMIPHLESGMKSSKSKDILSAEEVMQWSQSLEKLLANQMGQNV 98

  Fly    68 FKKYVEEEAPAYNDHLNFYFACEGLKQ-QTD--PEKIKQIIGAIYRFLRKSQLSISDDLR-AQIK 128
            |.|:::.|..  .:::.|:.|||..|: :||  ..|.:.|..|........|::|....| :..|
  Rat    99 FGKFLKSEFS--EENIEFWLACEDYKKTETDLLHNKAEHIYKAFVHSDAVKQINIDFHTRESTAK 161

  Fly   129 AIKTNPEIPLSPHIFDPMQRHVEVTIRDNIYPTFLCSEMYILYIQQMSA 177
            .|||.     :|..||..|:.:...:..:.||.||.|.:|:..:..:.|
  Rat   162 KIKTP-----TPTCFDEAQKVIYALMEKDSYPRFLKSNIYLNLLNDLQA 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AxnNP_733336.1 RGS 55..170 CDD:295367 34/118 (29%)
Axin_b-cat_bind 494..543 CDD:285982
DIX 665..739 CDD:279160
Rgs1XP_006250036.1 RGS 86..199 CDD:413378 34/119 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.