DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Axn and Rgs11

DIOPT Version :9

Sequence 1:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_001074538.1 Gene:Rgs11 / 50782 MGIID:1354739 Length:466 Species:Mus musculus


Alignment Length:253 Identity:53/253 - (20%)
Similarity:91/253 - (35%) Gaps:68/253 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GPRPPV-----PGEESRVKKMTEGVADTSKNSSPSYL---NWARTLNHLLEDRDGVELFKKYVEE 74
            ||..|:     |........:|....:....::|:.|   .|:.:...||:|..|...|..::::
Mouse   259 GPHDPIMSGCLPSNPWITDDVTYWAMNAPNVAAPTKLRVERWSFSFRELLDDPVGRAHFMDFLQK 323

  Fly    75 EAPAYNDHLNFYFACEGLKQQTDPEKIKQIIGAIY-RFLRKSQLS-ISDDLRAQIKAIKTNPEIP 137
            |..|.|  |:|:.|||.|:.....: :..::.::| :||...... |:.|.|...:.:    |..
Mouse   324 EFSAEN--LSFWEACEELRFGGQAQ-VPTLVDSVYQQFLAPGAARWINIDSRTMERTL----EGL 381

  Fly   138 LSPH--IFDPMQRHVEVTIRDNIYPTFLCSEMYILYIQQMSAQQERCTSSGATGSGSAGSSGSGG 200
            ..||  :.|..|.|:.:.::.:.||.||.|::|                                
Mouse   382 RQPHRYVLDAAQLHIYMLMKKDSYPRFLKSDIY-------------------------------- 414

  Fly   201 SSLAGACALPPTTASGKQQLPQLVPPGAFINLPVSSVSGP--------PAGTCSASGS 250
            ..|.....:|..|...         |..|:..|:.|...|        ||.|.|..|:
Mouse   415 KGLLEEAVIPLETKRW---------PFPFLRKPLHSSPSPALQSTPREPAATSSPEGA 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AxnNP_733336.1 RGS 55..170 CDD:295367 32/118 (27%)
Axin_b-cat_bind 494..543 CDD:285982
DIX 665..739 CDD:279160
Rgs11NP_001074538.1 DEP_RGS7-like 26..113 CDD:239897
GGL 224..284 CDD:128520 5/24 (21%)
RGS 295..420 CDD:295367 35/163 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.