DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Axn and Rgs3

DIOPT Version :9

Sequence 1:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster
Sequence 2:XP_006538120.1 Gene:Rgs3 / 50780 MGIID:1354734 Length:1143 Species:Mus musculus


Alignment Length:176 Identity:42/176 - (23%)
Similarity:72/176 - (40%) Gaps:41/176 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NECSGPRPPVPGEESRVKKMTEGVADTSKNSSPSYLNWARTLNHLLEDRDGVELFKKYVEEEAPA 78
            ||..|.:|     .|:..|.|:....||:.:    |.|:.:|..||..:.|:|:|:.::..|.. 
Mouse   987 NESPGAQP-----ASKTDKTTKSFKPTSEEA----LKWSESLEKLLLHKYGLEVFQAFLRTEFS- 1041

  Fly    79 YNDHLNFYFACEGLKQQTDPEKIKQIIGAIYRFLRKSQLSISDDLRAQIKAIKTNPEIPLSPH-- 141
             .::|.|:.|||..|:.....|:......|:               |:..||:...|:.|..:  
Mouse  1042 -EENLEFWLACEDFKKVKSQSKMAAKAKKIF---------------AEFIAIQACKEVNLDSYTR 1090

  Fly   142 -------------IFDPMQRHVEVTIRDNIYPTFLCSEMYILYIQQ 174
                         .||..|:.:...:..:.||.||.|::|:..|.|
Mouse  1091 EHTKENLQSITRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQ 1136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AxnNP_733336.1 RGS 55..170 CDD:295367 29/129 (22%)
Axin_b-cat_bind 494..543 CDD:285982
DIX 665..739 CDD:279160
Rgs3XP_006538120.1 C2_RGS-like 35..154 CDD:176067
PDZ_signaling 195..268 CDD:238492
PHA03307 578..>801 CDD:223039
RGS_RGS3 1019..1132 CDD:188668 29/129 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.