DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Axn and RGS21

DIOPT Version :10

Sequence 1:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_001034241.1 Gene:RGS21 / 431704 HGNCID:26839 Length:152 Species:Homo sapiens


Alignment Length:124 Identity:29/124 - (23%)
Similarity:59/124 - (47%) Gaps:10/124 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LNWARTLNHLLEDRDGVELFKKYVEEEAPAYNDHLNFYFACEGLKQQTDPEKIKQIIGAIY-RFL 112
            :.|:..::.||.::.|::.|:.:::.|..  .:::.|:.|||..|:..:.:||......|| .|:
Human    16 MTWSENMDTLLANQAGLDAFRIFLKSEFS--EENVEFWLACEDFKKTKNADKIASKAKMIYSEFI 78

  Fly   113 R---KSQLSISDDLRAQIKAIKTNPEIPLSPHIFDPMQRHVEVTIRDNIYPTFLCSEMY 168
            .   ..:::|....|..|......|.:    ..||..|:.:...:..:.:|.||.||:|
Human    79 EADAPKEINIDFGTRDLISKNIAEPTL----KCFDEAQKLIYCLMAKDSFPRFLKSEIY 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AxnNP_733336.1 RGS 55..170 CDD:470619 28/118 (24%)
Axin_b-cat_bind 495..530 CDD:462616
DIX 665..741 CDD:459936
RGS21NP_001034241.1 RGS_RGS21 25..135 CDD:188678 28/115 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.