DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Axn and Rgs4

DIOPT Version :9

Sequence 1:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_058910.1 Gene:Rgs4 / 29480 RGDID:3567 Length:205 Species:Rattus norvegicus


Alignment Length:210 Identity:44/210 - (20%)
Similarity:76/210 - (36%) Gaps:30/210 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HPSGIRKHDDNECSGPRPPVPGEESRVKKMTEGVADTSKNSSPSYLNWARTLNHLLEDRDGVELF 68
            |..|......:.|         |.|......:.|....:.|......||.:|.:|:....|:..|
  Rat    21 HRLGFLLQKSDSC---------EHSSSHSKKDKVVTCQRVSQEEVKKWAESLENLINHECGLAAF 76

  Fly    69 KKYVEEEAPAYN-DHLNFYFACEGLKQQTDPEKI----KQIIGAIYRFLRKSQLSISDDLRAQIK 128
            |.:::.|   |: ::::|:.:||..|:...|.|:    |:|...........::::....|.:..
  Rat    77 KAFLKSE---YSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETS 138

  Fly   129 AIKTNPEIPLSPHIFDPMQRHVEVTIRDNIYPTFLCSEMYILYIQQMSAQQERCTSSGATGSGSA 193
            .....|.|.    .||..|:.:...:..:.|..||.|..|:......|...|:  ..||..|...
  Rat   139 RNMLEPTIT----CFDEAQKKIFNLMEKDSYRRFLKSRFYLDLTNPSSCGAEK--QKGAKSSADC 197

  Fly   194 GSSGSGGSSLAGACA 208
                   :||...||
  Rat   198 -------TSLVPQCA 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AxnNP_733336.1 RGS 55..170 CDD:295367 26/119 (22%)
Axin_b-cat_bind 494..543 CDD:285982
DIX 665..739 CDD:279160
Rgs4NP_058910.1 RGS_RGS4 63..176 CDD:188669 26/119 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.