DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Axn and Rgs9

DIOPT Version :9

Sequence 1:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_035398.2 Gene:Rgs9 / 19739 MGIID:1338824 Length:675 Species:Mus musculus


Alignment Length:281 Identity:59/281 - (20%)
Similarity:102/281 - (36%) Gaps:67/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WARTLNHLLEDRDGVELFKKYVEEEAPAYNDHLNFYFACEGLKQQTDPEKIKQIIGAIYRFLRKS 115
            ||...:.|:.|..|.:.|:.::::|....|  |.|:.|||.|| ..|..|:|:....||:     
Mouse   296 WAFNFSELIRDPKGRQSFQYFLKKEFSGEN--LGFWEACEDLK-YGDQSKVKEKAEEIYK----- 352

  Fly   116 QLSISDDLRAQIKAIKTNPEIPLS----PH--IFDPMQRHVEVTIRDNIYPTFLCSEMY------ 168
             |.::...|..|.......:|.:.    ||  :.|..|.|:.:.::.:.|..:|.|.:|      
Mouse   353 -LFLAPGARRWINIDGKTMDITVKGLRHPHRYVLDAAQTHIYMLMKKDSYARYLKSPIYKEMLAK 416

  Fly   169 --------------------------ILYIQQMSAQQERCTSSGATGSGSAGSSGSGGSSLA--- 204
                                      .:.::|:..:::...::........|...:....||   
Mouse   417 AIEPQETTKRSSTLPFMRRHLRSSPSPVILRQLEEEEKAREAANTVDITQPGQHLAPSPHLAVYT 481

  Fly   205 GACALP----PTTASGKQQLPQLVPPGAFINLPVSSV------------SG-PPAGTCSASGSVY 252
            |.|..|    |.:.|.:........|..||..|..::            || .|.|..|.||:..
Mouse   482 GTCVPPSPSSPFSPSCRSPRKPFASPSRFIRRPSIAICPSPSRVALEGSSGLEPKGEASWSGANS 546

  Fly   253 GPSTSASSSGSISATDTLPRS 273
            |||.:.:...|...:...||:
Mouse   547 GPSVTENREPSADHSRPQPRA 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AxnNP_733336.1 RGS 55..170 CDD:295367 31/152 (20%)
Axin_b-cat_bind 494..543 CDD:285982
DIX 665..739 CDD:279160
Rgs9NP_035398.2 DEP_RGS7-like 22..109 CDD:239897
GGL 219..280 CDD:128520
RGS_RGS9 292..412 CDD:188693 33/124 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 524..571 13/44 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 637..662
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3589
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.