DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Axn and rgs-4

DIOPT Version :9

Sequence 1:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_001364555.1 Gene:rgs-4 / 189666 WormBaseID:WBGene00004347 Length:308 Species:Caenorhabditis elegans


Alignment Length:200 Identity:44/200 - (22%)
Similarity:85/200 - (42%) Gaps:20/200 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RKHDDNECSGPRPPVPGEESRVKKMTEGVADTSKNSSPSYLNWARTLNHLLEDRDGVELFKKYVE 73
            |:.::|:.:|.....|...:.:..::......|...||:  .|....:|::.|.||...|.|:::
 Worm   112 RRSNENQSNGNGSTPPTSANNMNMISPNQVPPSPRLSPN--EWQFAFDHVIYDVDGRAQFTKFLQ 174

  Fly    74 EEAPAYN-DHLNFYFACEGLKQQTDPE---KIKQIIGAIY-RFLRKSQ---LSISDDLRAQIKAI 130
            .|   |: :::.|::|.|.||.....|   |.:..:..:| .|:....   ::|..|.|..|.|:
 Worm   175 SE---YSEENILFWWAVEELKAVGVSEGRTKFESTVQEMYDTFIAAESPLAINIDHDTRTDIIAL 236

  Fly   131 KTNPEIPLSP-HIFDPMQRHVEVTIRDNIYPTFLCSEMYILYIQQMSAQQE------RCTSSGAT 188
            ....|....| :|::..|.||...:..:.:..|:.:..|....:::|..|.      |....|.|
 Worm   237 VEGKEPSTFPENIYERAQAHVYRLMEKDCFSRFVHTNAYKDVAKKLSLPQTFRFNCIRLQPGGPT 301

  Fly   189 GSGSA 193
            ...:|
 Worm   302 AQAAA 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AxnNP_733336.1 RGS 55..170 CDD:295367 30/123 (24%)
Axin_b-cat_bind 494..543 CDD:285982
DIX 665..739 CDD:279160
rgs-4NP_001364555.1 RGS 156..277 CDD:214613 30/123 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.