Sequence 1: | NP_733336.1 | Gene: | Axn / 43565 | FlyBaseID: | FBgn0026597 | Length: | 745 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001364555.1 | Gene: | rgs-4 / 189666 | WormBaseID: | WBGene00004347 | Length: | 308 | Species: | Caenorhabditis elegans |
Alignment Length: | 200 | Identity: | 44/200 - (22%) |
---|---|---|---|
Similarity: | 85/200 - (42%) | Gaps: | 20/200 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 RKHDDNECSGPRPPVPGEESRVKKMTEGVADTSKNSSPSYLNWARTLNHLLEDRDGVELFKKYVE 73
Fly 74 EEAPAYN-DHLNFYFACEGLKQQTDPE---KIKQIIGAIY-RFLRKSQ---LSISDDLRAQIKAI 130
Fly 131 KTNPEIPLSP-HIFDPMQRHVEVTIRDNIYPTFLCSEMYILYIQQMSAQQE------RCTSSGAT 188
Fly 189 GSGSA 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Axn | NP_733336.1 | RGS | 55..170 | CDD:295367 | 30/123 (24%) |
Axin_b-cat_bind | 494..543 | CDD:285982 | |||
DIX | 665..739 | CDD:279160 | |||
rgs-4 | NP_001364555.1 | RGS | 156..277 | CDD:214613 | 30/123 (24%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |